Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34420xadA2XFF4834R_chr34420adhesin XadA

xadA2 XFF4834R_chr34420
XFF4834R_chr34410
XFF4834R_chr34410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34430
XFF4834R_chr34430
ID xadA2
AC XFF4834R_chr34420
LT XFF4834R_chr34420
OR XFF4834R_chr from 3985996 to 3989193 on strand -
DE adhesin XadA
IP YadA-like, C-terminal; Haemagluttinin motif
CL 4.2.A.64 The Type V Secretory Pathway or Twin Arginine Targeting (Tat) Family
EC
GO InterPro
Biological Process: pathogenesis (GO:0009405)
Cellular Component: outer membrane (GO:0019867)

Curated
PM
AN preuve fonctionnelle chez Xapf4834, role dans la transmission vasculaire aux semences
CC COG: [SUW] Function unknown;Intracellular trafficking, secretion, and vesicular transport;Extracellular structures;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110323)
MW 101639.5 Da
SQ 1065 aa
 
........10........20........30........40........50
| | | | |
MKRIYLEAGRGSFAHDQTVPRARTVGNTQGRLPRDHAGGVLATAMAIVLF
GMAGAAGAATTPAAAITQCQVVDGRLRCPGEAGTVAQTATAGSNDSATQA
AVIAAADAQIPAFADGEDALALGNASNALGDGTMALGGGSLALDRDATAI
GHNAAAAGESSIALGGVATVFDYDANGFVIGQREQATQASGVGATAVGGG
ALAGTPYASAIGSGASASGVQSTALGYRAQTSSDGATAVGGLSSASGFLS
TAGGYSSRASADTSTAFGYRARSDGASSVAVGDTSLASGAQSVVVGGVSN
FGSITAATGLGGIALGSGAQSQSDYAIAIGYDSNVFPNAPGNTDAVAIGH
SAGSFAPRTVSLGGFALASGDGGIAIGHGSTAYNENGVALGARAATSQFN
GDSTVVGADAQANGVDAVAIGYGAKVGSWVDDAWNRSASSAVALGAHSYA
FRSNTVSVGDVQAGLTRQITSVAAGTEATDAVNVAQLDPVRAATSRIDGY
LAVTPATTDATAASAQGQGAMALGGASSALGASATAVGFNASSVGQSSSA
LGSLAVAAGERSVAVASGSRAAATGASALGADSSASGVNSTAMGRQTNSI
GENGVALGYNAFVRESGSNAVALGANAGASGADSVALGSGSRTYDADTVS
VGSGNGRGGPATRRIVNVGAGTIASASTDAINGGQLFQSLSNAASFLGGG
AAIGAQGVFVAPTYVIQGASYNNVGAALTALDSKVSELDARGGAATAASR
ASVTRLATARATGGDATADGLPSAALATDATTDSALSSAATATATGLSES
TAVQGTPTAAMDGSITPAATSTAVGTAAVANHVTGTAIGGSAYAHGPNDT
AIGSNARVNADGSTAVGANTQIAAVATNAVAMGEGAQVTAASGTAIGQGA
RATAQGAVALGQGAVADRANTVSVGSVGGERQVANVAAGTRATDAVNKGQ
LDSGVAAANSYTDSRYNAMADSFESYQGDIEDRLRRQNRRLDRQGAMSSA
MLNMSASVAGIASQNRIGAGVGFQNGESALSVGYQRAISPRATVTVGGAL
SGDDRSVGLGAGFGW
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

803

1065

S=962 I=77 E=1.77349e-109

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

589

739

S=676 I=98 E=7.79048e-75

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

589

686

S=354 I=76 E=7.94582e-36

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

589

686

S=334 I=72 E=2.21933e-33

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

353

498

S=169 I=45 E=2.36073e-13

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

221

501

S=163 I=32 E=1.09514e-12

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

344

501

S=151 I=40 E=2.93078e-11

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

836

952

S=145 I=43 E=1.57681e-10

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

235

490

S=136 I=31 E=1.89205e-09

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

359

490

S=128 I=43 E=2.04479e-08

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

836

951

S=116 I=38 E=5.05921e-07

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

894

978

S=116 I=45 E=6.07574e-07

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

340

490

S=108 I=34 E=5.05499e-06

XFF4834R

XFF4834R_chr34400 lcl|XFF4834R_chr37380438_3983469_r1_XFF4834R-XFF4834R_chr34400

833

979

S=104 I=33 E=1.78963e-05

X.species

NP_643855.2 lcl|xadA-XAC3548

1

739

S=2290 I=68 E=0

outer membrane protein

X.species

NP_643855.2 lcl|xadA-XAC3548

803

1065

S=956 I=77 E=3.1679e-108

outer membrane protein

X.species

NP_643855.2 lcl|xadA-XAC3548

353

498

S=167 I=45 E=1.25506e-12

outer membrane protein

X.species

NP_643855.2 lcl|xadA-XAC3548

835

963

S=134 I=42 E=1.24001e-08

outer membrane protein

X.species

YP_365403.1 lcl|xadA2-XCV3672

1

739

S=2264 I=69 E=0

adhesin XadA

X.species

YP_365403.1 lcl|xadA2-XCV3672

803

1065

S=956 I=77 E=4.00873e-108

adhesin XadA

X.species

YP_365403.1 lcl|xadA2-XCV3672

353

498

S=165 I=45 E=2.35121e-12

adhesin XadA

X.species

YP_365403.1 lcl|xadA2-XCV3672

835

963

S=126 I=40 E=1.14547e-07

adhesin XadA

X.species

NP_643853.1 lcl|xadA-XAC3546

803

1065

S=961 I=77 E=9.93496e-109

outer membrane protein

X.species

NP_643853.1 lcl|xadA-XAC3546

589

739

S=677 I=99 E=2.26941e-74

outer membrane protein

Iprscan [G3DSA:2.150.10.10]

93

175

-

Iprscan [G3DSA:2.150.10.10]

187

297

-

Iprscan [G3DSA:2.150.10.10]

301

493

-

Iprscan [G3DSA:2.150.10.10]

494

692

-

Iprscan [G3DSA:2.150.10.10]

808

957

-

Iprscan IPR008640 [PF05658]

114

140

Hep/Hag

Iprscan IPR008640 [PF05658]

146

169

Hep/Hag

Iprscan IPR008640 [PF05658]

217

243

Hep/Hag

Iprscan IPR008640 [PF05658]

245

271

Hep/Hag

Iprscan IPR008640 [PF05658]

368

394

Hep/Hag

Iprscan IPR008640 [PF05658]

402

424

Hep/Hag

Iprscan IPR008640 [PF05658]

600

627

Hep/Hag

Iprscan IPR008640 [PF05658]

844

871

Hep/Hag

Iprscan IPR008635 [PF05662]

467

487

Haemagluttinin motif

Iprscan IPR008635 [PF05662]

663

686

Haemagluttinin motif

Iprscan IPR008635 [PF05662]

931

951

Haemagluttinin motif

Iprscan IPR005594 [PF03895]

988

1065

YadA-like, C-terminal

Iprscan [seg]

53

65

-

Iprscan [seg]

97

115

-

Iprscan [seg]

118

132

-

Iprscan [seg]

147

157

-

Iprscan [seg]

185

204

-

Iprscan [seg]

208

219

-

Iprscan [seg]

285

299

-

Iprscan [seg]

302

323

-

Iprscan [seg]

502

538

-

Iprscan [seg]

541

559

-

Iprscan [seg]

562

588

-

Iprscan [seg]

740

771

-

Iprscan [seg]

773

802

-

Iprscan [seg]

816

830

-

Iprscan [seg]

902

916

-

Iprscan [seg]

982

994

-

Iprscan [seg]

996

1009

-

Iprscan [tmhmm]

37

59

-

Iprscan [SSF101967]

508

692

-

Iprscan [SSF101967]

780

957

-

Iprscan [SSF101967]

300

493

-

Iprscan [SSF101967]

182

296

-

Iprscan [SSF101967]

83

181

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one bEl3Xd01)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

15 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

40 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNTQNDB/XFF4834R_chr34420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNTQNDB/XFF4834R_chr34420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNTQNDB/XFF4834R_chr34420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNTQNDB/XFF4834R_chr34420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.