Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00730XFF4834R_chr00730Conserved hypothetical protein

XFF4834R_chr00730
XFF4834R_chr00720
XFF4834R_chr00720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00740
XFF4834R_chr00740
ID
AC XFF4834R_chr00730
LT XFF4834R_chr00730
OR XFF4834R_chr from 86172 to 86567 on strand -
DE Conserved hypothetical protein
IP EF-hand-like domain
CL 10.2 Conserved hypothetical protein
EC
GO InterPro
Molecular Function: calcium ion binding (GO:0005509)

Curated
PM
AN Start codon starts 19 codons upstream
CC COG: [DRSTZ] Cell cycle control, cell division, chromosome partitioning;General function prediction only;Function unknown;Signal transduction mechanisms;Cytoskeleton;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101121)
MW 14415.2 Da
SQ 131 aa
 
........10........20........30........40........50
| | | | |
VVRKAGARRAVVRVHRVRGVIVRTLVIVGLAALPAVAAQAQVQDSQQYLQ
RMDADGDGRVSLDEYLAWMSYAFDQRDTDHDGVLQGDELPGRRGKPITRA
AHRATLIARFARQDADGDGYLSARELLAPPR
XFF4834R

YP_361896.1 XCV0165

51

131

S=411 I=99 E=2.46589e-43

putative secreted protein

XFF4834R

NP_640537.1 XAC0181-XAC0181

51

131

S=402 I=98 E=2.71183e-42

hypothetical protein

XFF4834R

NP_635558.1 XCC0163

51

131

S=384 I=91 E=4.81334e-40

hypothetical protein

XFF4834R

XALc_3165 XALc_3165

51

131

S=309 I=75 E=5.30421e-31

hypothetical protein

Iprscan IPR011992 [G3DSA:1.10.238.10]

46

127

EF-hand-like domain

Iprscan [PTHR10891]

39

128

-

Iprscan IPR018247 [PS00018]

53

65

EF-Hand 1, calcium-binding site

Iprscan IPR018247 [PS00018]

114

126

EF-Hand 1, calcium-binding site

Iprscan IPR018247 [PS00018]

77

89

EF-Hand 1, calcium-binding site

Iprscan IPR018249 [PS50222]

40

75

EF-HAND 2

Iprscan IPR018249 [PS50222]

101

131

EF-HAND 2

Iprscan [seg]

1

23

-

Iprscan [seg]

25

50

-

Iprscan [SignalP-NN(euk)]

1

38

-

Iprscan [tmhmm]

20

42

-

PD924339

90

131

S=207 I=100 E=1.10896e-17

Iprscan [SSF47473]

36

126

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QAiaoJpy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvtpGU0/XFF4834R_chr00730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvtpGU0/XFF4834R_chr00730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvtpGU0/XFF4834R_chr00730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvtpGU0/XFF4834R_chr00730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.