Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr08720XFF4834R_chr09320750_1014697_r3_XFF4834R-XFF4834R_chr08720XFF4834R_chr08720putative histone deacetylase superfamily protein
  2. XFF4834R_chr35920XFF4834R_chr39090524_4162228_f2_XFF4834R-XFF4834R_chr35920XFF4834R_chr35920Hypothetical protein

XFF4834R_chr09320750_1014697_r3_XFF4834R-XFF4834R_chr08720 XFF4834R_chr08720
XFF4834R_chr_0948
XFF4834R_chr_0948
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08730
XFF4834R_chr08730
ID XFF4834R_chr09320750_1014697_r3_XFF4834R-XFF4834R_chr08720
AC XFF4834R_chr08720
LT XFF4834R_chr08720
OR XFF4834R_chr from 1013750 to 1014697 on strand -
DE putative histone deacetylase superfamily protein
IP Histone deacetylase superfamily
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [BQ] Chromatin structure and dynamics;Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110712)
MW 34487.8 Da
SQ 315 aa
 
........10........20........30........40........50
| | | | |
MLVFTHPACLGHDAGPEHPESPARLEAVVQALRGAFPDLDWREAPLAKLG
DLCRVHEREQVDAVLETAFDGYRQLDVDTRMVPASRAAALRAAGAGIAAV
DAVMQDQTRTAFCAVRPPGHHATAQVSMGFCLFNNIAVAAAHARDRHGLE
RITIVDFDVHHGNGTQAIFERDPAVQYLSTHQSGLYPHSGSVYERGVGNI
HNLLLPPGSDGLRFRNVWEDEMLPLIDAFRPQLILISAGFDAHLRDPLAD
LMLDDADFAWLTGALRTLADRHARGRVVSMLEGGYDLQALAECSIAHVRV
LLQQTTLNLLLKDKK
XFF4834R

XFF4834R_chr_0948 lcl|XFF4834R_chr09310683_1012865_r2_XFF4834R-XFF4834R_chr_0948

262

298

S=170 I=92 E=4.40568e-14

X.species

NP_641221.1 lcl|XAC0869-XAC0869

1

300

S=1344 I=87 E=9.35814e-156

acetoin utilization family protein

X.species

YP_362635.1 lcl|XCV0904

1

298

S=1310 I=85 E=1.02657e-151

histone deacetylase family protein

X.species

NP_636186.1 lcl|XCC0795

1

298

S=1214 I=80 E=4.97216e-140

acetoin utilization family protein

X.species

lcl|XALc_2760

1

298

S=1007 I=65 E=6.21585e-115

putative histone deacetylase superfamily protein

X.species

NP_641219.1 lcl|XAC0867-XAC0867

262

298

S=171 I=92 E=1.30794e-13

hypothetical protein

pubmed

111

299

S=347 I=37 E=2.41255e-33

Type-2 histone deacetylase 2 EC=3.5.1.98 ; Chromatin regulator Cytoplasm Hydrolase Metal-binding Nucleus Repressor Transcription regulation

Pubmed 19576222

 

prodomImg

pubmed

107

296

S=336 I=39 E=4.24851e-32

Histone deacetylase-like amidohydrolase EC=3.5.1.- ; Zinc

Pubmed 15060035

 

prodomImg

pubmed

9

291

S=332 I=31 E=1.54397e-31

Histone deacetylase 6 isoform A ; Hydrolase

Pubmed 19349642

 

prodomImg

pubmed

17

292

S=305 I=31 E=2.42354e-28

Histone deacetylase 6 isoform A ; Hydrolase

Pubmed 19349642

 

prodomImg

pubmed

9

291

S=332 I=31 E=1.62689e-31

Histone deacetylase 6 isoform C ; Hydrolase

Pubmed 19349642

 

prodomImg

sp

10

299

S=426 I=35 E=4.71663e-43

Uncharacterized protein slr0245 ; Hydrolase

 

prodomImg

sp

2

292

S=422 I=35 E=1.11814e-42

Histone deacetylase 14 EC=3.5.1.98 ; Chromatin regulator Hydrolase Nucleus Repressor Transcription regulation

 

prodomImg

sp

2

289

S=373 I=33 E=1.08383e-36

Uncharacterized protein AF_0130 ; Hydrolase

 

prodomImg

sp

18

299

S=363 I=36 E=1.90863e-35

Uncharacterized protein MTH_1194 ; Hydrolase

 

prodomImg

sp

111

299

S=347 I=37 E=1.64295e-33

Type-2 histone deacetylase 2 EC=3.5.1.98 ; Chromatin regulator Cytoplasm Hydrolase Metal-binding Nucleus Repressor Transcription regulation

 

prodomImg

Iprscan IPR000286 [PR01270]

117

140

Histone deacetylase superfamily

Iprscan IPR000286 [PR01270]

151

166

Histone deacetylase superfamily

Iprscan IPR000286 [PR01270]

231

241

Histone deacetylase superfamily

Iprscan IPR000286 [G3DSA:3.40.800.20]

1

305

Histone deacetylase superfamily

Iprscan [PTHR10625:SF20]

34

302

-

Iprscan IPR000286 [PTHR10625]

34

302

Histone deacetylase superfamily

Iprscan IPR000286 [PF00850]

15

301

Histone deacetylase superfamily

Iprscan [seg]

84

103

-

Iprscan [seg]

244

261

-

Iprscan [seg]

301

311

-

PD001400

104

293

S=348 I=40 E=1.12598e-34

PD930898

29

83

S=277 I=96 E=3.89134e-26

PDA23886

185

243

S=113 I=41 E=2.92054e-06

PDA212Z0

54

135

S=103 I=33 E=5.09844e-05

Iprscan [SSF52768]

1

313

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nXJ6a4MN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

130 hits
swiss-prot

Swiss-Prot ncbi-blastp

94 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr08720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr08720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr08720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr08720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr39090524_4162228_f2_XFF4834R-XFF4834R_chr35920 XFF4834R_chr35920
XFF4834R_chr35910
XFF4834R_chr35910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35930
XFF4834R_chr35930
ID XFF4834R_chr39090524_4162228_f2_XFF4834R-XFF4834R_chr35920
AC XFF4834R_chr35920
LT XFF4834R_chr35920
OR XFF4834R_chr from 4161524 to 4162228 on strand +
DE Hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [BKL] Chromatin structure and dynamics;Transcription;Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120306)
MW 24624.7 Da
SQ 234 aa
 
........10........20........30........40........50
| | | | |
MPAKTVRPGRPAASTGQPRYASHRAAHALEWPAIPSVENTVSRNSKAKRD
KRKKQQPKRPFVRLGQAPQVTNHAVLQDADGRVVAAIGLQGGSEWMLSIG
GQTMGSADNPVPMLAMLKHLANLQEAEGKTISLEYSTQLQQMIDDLAADE
GQTAEEYLTKLVSEFQNADAGEDGDAEDAAEDAGTEAGADDVAEDDTASA
TDTAADASDEASDTAADEPDGASDGKKPKKSKKA
X.species

NP_644002.1 lcl|XAC3695-XAC3695

1

167

S=763 I=88 E=1.42085e-85

hypothetical protein

X.species

YP_365547.1 lcl|XCV3816

8

167

S=717 I=88 E=5.00933e-80

hypothetical protein

X.species

NP_639001.1 lcl|XCC3655

24

167

S=606 I=82 E=1.33883e-66

hypothetical protein

X.species

lcl|XALc_2944

38

165

S=393 I=61 E=1.07203e-40

hypothetical protein

Iprscan [seg]

46

60

-

Iprscan [seg]

168

234

-

PD685521

61

166

S=502 I=91 E=2.46915e-53

PD643178

8

41

S=152 I=88 E=5.36365e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one C5tsonTM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr35920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr35920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr35920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBldMopR/XFF4834R_chr35920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.