Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr00200XFF4834R_chr00200probable long-chain fatty acid outer membrane transporter
  2. XFF4834R_chr40000XFF4834R_chr_4617495_4618571_f3_XFF4834R-XFF4834R_chr40000XFF4834R_chr40000putative FecR family transmembrane sensor protein

XFF4834R_chr00200
XFF4834R_chr00190
XFF4834R_chr00190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00210
XFF4834R_chr00210
ID
AC XFF4834R_chr00200
LT XFF4834R_chr00200
OR XFF4834R_chr from 20911 to 22251 on strand -
DE probable long-chain fatty acid outer membrane transporter
IP Membrane protein, aromatic hydrocarbon degradation
CL 4.1.B.9 The FadL Outer Membrane Protein (FadL) Family
EC
GO InterPro


Curated
PM
AN gene nomme au depart trouve pas d homologie suffisante chez coli ou bacsub fadL en faisant 1 blastp 28% sur 89% de la totalite pas d'interpro?
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 47282.8 Da
SQ 446 aa
 
........10........20........30........40........50
| | | | |
MSTASTLSRATLLAVGIAGVLAVGQAHGAAFQLKENSAKGLGRAFAGSGS
APDDASIIATNPAGMRQLDGRLFQADVSAISFSAKFQPDTAAYANGAPVS
GGNGGDAGMIAPVPALYFHVPFGENDNMHLGTSLTVPFGFKTEYDRDWVG
RYHGTKTELQAIDFNVAFSYDVNPYVSFGASVFAERLDIDLANAVDFGSV
LAARRVPGFAPGSADGYSRIKGDSTEVGFTLGGLFSIDENTHIGFSYRSQ
VEHKITDGTADFTVPGSAAAVLSVAAPGTFVDTKGRATVKLPASATASFT
HNVNEQWSIMADVTRTAWSKFDQVTVDFASNQPDSVLDFSYRDTTFASIG
ADYRLSDTVTLRGGLAYDQTPTTAEHRDVRVPDASRKWVSLGMSWRPSAQ
TEYNFGYTHLFTSDPTSDTRSATGDRLAGSYDVKGDVLAASINYKF
Show or not Domain decomposition
 
XFF4834R

NP_640375.1 lcl|ompP1-XAC0019

1

446

S=2326 I=100 E=0

outer membrane protein

XFF4834R

YP_361751.1 lcl|fadL-XCV0020

1

446

S=2314 I=99 E=0

FadL family outer membrane protein

XFF4834R

NP_635412.1 lcl|ompP1-XCC0017

1

446

S=2094 I=92 E=0

outer membrane protein

XFF4834R

lcl|fadL-XALc_0397

1

446

S=1873 I=77 E=0

probable long-chain fatty acid outer membrane transporter, fadl protein

Iprscan IPR005017 [PF03349]

20

446

Membrane protein, aromatic hydrocarbon degradation

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [tmhmm]

7

29

-

Iprscan [SSF56935]

29

446

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0mow9u5u)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

89 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr00200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr00200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr00200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr00200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4617495_4618571_f3_XFF4834R-XFF4834R_chr40000 XFF4834R_chr40000
XFF4834R_chr39990
XFF4834R_chr39990
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4261
XFF4834R_chr_4261
ID XFF4834R_chr_4617495_4618571_f3_XFF4834R-XFF4834R_chr40000
AC XFF4834R_chr40000
LT XFF4834R_chr40000
OR XFF4834R_chr from 4617495 to 4618571 on strand +
DE putative FecR family transmembrane sensor protein
IP Fe(2+)-dicitrate sensor, transmembrane component
CL 4.S.95 iron dicitrate GO:0015688 GO:0015623
EC
GO InterPro


Curated
PM
AN
CC COG: [PT] Inorganic ion transport and metabolism;Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100802)
MW 39422.4 Da
SQ 358 aa
 
........10........20........30........40........50
| | | | |
MVVSVASQAARRLTEEAAHWHALQRMQPLDADQQARFMEWLTASPAHVRE
YLAVTRVAGALGEALDAMALDVEALLQAERQRDTGPARNVVALPLPPRRP
VAAGGTARSRSAARRSHWHVGLAAMLGLLTVLGGWAWPRTTTYATAHGEQ
RRVQLADRSVVFLNADTRIQATITPWSRHLQLLQGQASFDVAPDRRPLQV
RALDLRVEDIGTAFDIALHGQQARIDVSAGRVHVWRADRPAQPMLANLGA
GQSARIDGAGQVQLSNEDVAIMHAWQQQRIVFRDEPLRNVAEDFNRLNRI
QLHIDDPRAGAMRLTGNLRSDDLAGLHAFLARQPGLRLEQQASALHIVSR
APPATANR
XFF4834R

NP_644429.1 lcl|XAC4130-XAC4130

3

358

S=1566 I=88 E=0

transmembrane sensor

XFF4834R

YP_365954.1 lcl|XCV4223

1

357

S=1526 I=86 E=8.67548e-178

FecR family transmembrane sensor protein

XFF4834R

NP_642509.1 lcl|XAC2192-XAC2192

10

350

S=203 I=26 E=1.96333e-17

two-component system sensor protein

XFF4834R

NP_638940.1 lcl|fecR-XCC3594

140

342

S=111 I=26 E=2.83025e-06

transmembrane sensor

pubmed

143

352

S=181 I=32 E=3.68963e-13

PupR protein

Pubmed 8026465

 

prodomImg

pubmed

138

304

S=135 I=29 E=1.21317e-07

BhoE

Pubmed 17041054

 

prodomImg

pubmed

143

318

S=130 I=27 E=5.11321e-07

FecR

Pubmed 11553538

 

prodomImg

pubmed

143

318

S=130 I=27 E=5.11321e-07

Transmembrane signal transducer for ferric citrate transport

Pubmed 18039831

 

prodomImg

pubmed

143

318

S=130 I=27 E=5.11321e-07

Protein fecR ; Ion transport Iron Periplasm Sensory transduction

Pubmed 2254251

 

prodomImg

sp_Pdown

sp|P23485|FECR_ECOLI

143

318

S=130 I=27 E=3.48059e-07

Protein fecR ; Ion transport Iron Periplasm Sensory transduction

Iprscan IPR012373 [PIRSF018266]

10

352

Fe(2+)-dicitrate sensor, transmembrane component

Iprscan IPR006860 [PF04773]

142

232

FecR protein

Iprscan [seg]

90

103

-

Iprscan [seg]

107

116

-

Iprscan [tmhmm]

118

137

-

PDA2P9E0

300

357

S=252 I=88 E=5.35225e-23

PD671273

62

133

S=182 I=58 E=1.52687e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one yovQPLF3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr40000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr40000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr40000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMERxdN/XFF4834R_chr40000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.