Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10350cvpAXFF4834R_chr10350probable colicin V production protein

cvpA XFF4834R_chr10350
XFF4834R_chr10340
XFF4834R_chr10340
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10360
XFF4834R_chr10360
ID cvpA
AC XFF4834R_chr10350
LT XFF4834R_chr10350
OR XFF4834R_chr from 1175201 to 1175947 on strand +
DE probable colicin V production protein
IP Colicin V production protein
CL 8.4 Colicin related
EC
GO InterPro
Biological Process: toxin biosynthetic process (GO:0009403)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100505)
MW 25773 Da
SQ 248 aa
 
........10........20........30........40........50
| | | | |
MIDMVLGVIILVSALLGLLRGFVAIVVGTLSWLLAGWATFLFGGAAARWL
ADGKHPSATESFGGYAMVFVGVLITVAVIGMVIRAGVDAVKLGGTDRMLG
FGLGVVRGAFLASVLVLLMGFTPLPREPAWRQSVLLPMLQPGAGWMRAQL
PSWRMPSMEMPSMELGNLPTELGKLPSAGDNTDLGKALGGSGLSDTITRA
LGKPGKTAGDGRDPTQAMPANIDPAQVRGGESDPARVESQGQARPPSQ
XFF4834R

YP_362791.1 lcl|cvpA-XCV1060

1

248

S=1223 I=98 E=2.50515e-141

colicin V production protein

XFF4834R

NP_641378.1 lcl|cvpA-XAC1031

1

248

S=1217 I=97 E=1.61862e-140

colicin V production protein

XFF4834R

NP_636338.1 lcl|cvpA-XCC0952

1

248

S=1164 I=93 E=4.42797e-134

colicin V production protein

XFF4834R

lcl|cvpA-XALc_0566

1

248

S=741 I=60 E=7.41386e-83

probable colicin v production protein

pubmed

9

147

S=177 I=35 E=6.26021e-13

Colicin V production protein

Pubmed 11145267

 

prodomImg

pubmed

2

140

S=136 I=29 E=5.23655e-08

Colicin V production protein ; Cell inner membrane Transmembrane

Pubmed 3040734,2991286

 

prodomImg

sp_Pdown

sp|P45108|CVPA_HAEIN

13

152

S=155 I=34 E=1.91459e-10

Colicin V production protein homolog ; Cell membrane Transmembrane

sp_Pdown

sp|P08550|CVPA_ECOLI

2

140

S=136 I=29 E=3.61214e-08

Colicin V production protein ; Cell inner membrane Transmembrane

PD602578

177

248

S=348 I=95 E=1.12723e-34

PD713781

118

156

S=203 I=97 E=4.00373e-17

PD034569

1

121

S=162 I=34 E=3.46791e-12

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Wmt6Qc4V)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAC0v7M/XFF4834R_chr10350.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAC0v7M/XFF4834R_chr10350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAC0v7M/XFF4834R_chr10350.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAC0v7M/XFF4834R_chr10350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.