Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr13700XFF4834R_chr_1570777_1571667_f1_XFF4834R-XFF4834R_chr13700XFF4834R_chr13700putative plasmid mobilization protein
  2. XFF4834R_chr13750XFF4834R_chr_1573496_1575136_f2_XFF4834R-XFF4834R_chr13750XFF4834R_chr13750Putative plasmid mobilization protein
  3. XFF4834R_chr32100XFF4834R_chr34700026_3688624_r3_XFF4834R-XFF4834R_chr32100XFF4834R_chr32100putative MobA/MobL protein
  4. XFF4834R_pla00410XFF4834R_pla00310044_0033646_r2_XFF4834R-XFF4834R_pla00410XFF4834R_pla00410putative lytic transglycosylase
  5. XFF4834R_pla00420XFF4834R_pla00310627_0034163_r1_XFF4834R-XFF4834R_pla00420XFF4834R_pla00420putative conjugal transfer protein TraF; peptidase
  6. XFF4834R_plb00190XFF4834R_plb00150146_0018874_r2_XFF4834R-XFF4834R_plb00190XFF4834R_plb00190putative protein TraL
  7. XFF4834R_plb00200XFF4834R_plb00150884_0019273_r2_XFF4834R-XFF4834R_plb00200XFF4834R_plb00200putative TraD protein
  8. XFF4834R_plc00150XFF4834R_plc00150Putative plasmid transfer protein TraD

XFF4834R_chr_1570777_1571667_f1_XFF4834R-XFF4834R_chr13700 XFF4834R_chr13700
XFF4834R_chr13690
XFF4834R_chr13690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13710
XFF4834R_chr13710
ID XFF4834R_chr_1570777_1571667_f1_XFF4834R-XFF4834R_chr13700
AC XFF4834R_chr13700
LT XFF4834R_chr13700
OR XFF4834R_chr from 1570777 to 1571667 on strand +
DE putative plasmid mobilization protein
IP MobA/MobL protein
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro
Biological Process: unidirectional conjugation (GO:0009291)

Curated
PM
AN premier hit blastx avec Xcv : I=67% ; E=10-84 ; S=316 et 79% coverage avec plasmid mobilization protein ; 4 hits Xcv avec (putative) MobA/MobL family protein et 3 hits Xac pour plasmid mobilization prot ET 1 dom interpro MobA/MobL DONC PUTATIVE plasmid mobilization protein Rem : 2 hits pubmed avec E coli : 2 articles avec analyse fonctionnelle pour MobA seulement ET 1 article avec analyse de seq seulement pour mobilization plasmid ET I=35% seulement donc putative ET NON PROBABLE plasmid mobilization protein.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20100713)
MW 33026.8 Da
SQ 296 aa
 
........10........20........30........40........50
| | | | |
MAIYYTRIKTYSRSKGHSAVAAAAYRGGYLLTDPKSGARHDYRGRAGIIQ
SRCLAPPGSPAWIDDPQALWAAAEAAERRHNSTVGRDFSIALPHELDDPK
RWELVLDIAHRLIERFGFALQASHHRPTKDDPRYFYAHLLATTRRMEACG
LTQKTRVLDGRINGLAEIQWIRAMIADRINAHLAQAGIGKAVEHRPLTER
LEAMRGNEILVQGHASFEQLLSRYRQEGRLLSVPDGRRAEQAQRERQGLG
MDTSADETSVARMAIMPASVGRLSSSRDDEAQLAAQGDPHDHPDSR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr32100 lcl|XFF4834R_chr34700026_3688624_r3_XFF4834R-XFF4834R_chr32100

1

197

S=536 I=53 E=1.60158e-58

XFF4834R

XFF4834R_chr13750 lcl|XFF4834R_chr_1573496_1575136_f2_XFF4834R-XFF4834R_chr13750

1

207

S=342 I=37 E=5.46611e-35

XFF4834R

YP_365109.1 lcl|XCV3378

1

195

S=513 I=49 E=3.67323e-55

putative MobA/MobL family protein

XFF4834R

YP_362854.1 lcl|XCV1123

1

195

S=511 I=49 E=6.30683e-55

MobA/MobL family protein

XFF4834R

NP_643568.1 lcl|mobL-XAC3260

1

223

S=476 I=49 E=1.0887e-50

plasmid mobilization protein

XFF4834R

NP_641442.1 lcl|mobL-XAC1104

11

195

S=466 I=48 E=2.12867e-49

plasmid mobilization protein

XFF4834R

NP_641841.1 lcl|mobL-XAC1507

1

197

S=346 I=38 E=7.06895e-35

plasmid mobilization protein

XFF4834R

YP_362824.1 lcl|XCV1093

1

197

S=329 I=42 E=7.37161e-33

putative MobA/MobL family protein

XFF4834R

YP_361502.1 lcl|XCVb0008

1

195

S=270 I=35 E=1.11372e-25

MobA/MobL family plasmid mobilization protein

pubmed

1

192

S=299 I=35 E=1.52119e-27

ORF504 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

1

188

S=297 I=37 E=2.50042e-27

ORF237 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

1

200

S=276 I=35 E=8.17057e-25

TraA ; Plasmid

Pubmed 17158670,20118371

 

prodomImg

pubmed

2

195

S=272 I=41 E=2.89265e-24

Mobilization protein ; Plasmid

Pubmed 12570988

 

prodomImg

pubmed

1

195

S=271 I=35 E=3.79033e-24

Putative mobilization protein ; Plasmid

Pubmed 16828160

 

prodomImg

sp_Pdown

sp|P20085|MOBL_THIFE

1

138

S=188 I=34 E=2.67327e-14

Mobilization protein mobL ; Conjugation Mobility Plasmid

sp_Pdown

sp|P55418|TRAA_RHISN

1

160

S=139 I=27 E=2.35426e-08

Probable conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

sp_Pdown

sp|Q44349|TRAA_AGRT5

1

160

S=124 I=26 E=1.32197e-06

Conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

sp_Pdown

sp|Q8GN32|MOBA_BIFLO

1

147

S=123 I=25 E=2.02656e-06

Probable mobilization protein MobA ; Conjugation Mobility Plasmid

sp_Pdown

sp|Q44363|TRAA_RHIRD

1

144

S=115 I=25 E=1.61416e-05

Conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

Iprscan IPR005053 [PF03389]

18

199

MobA/MobL protein

Iprscan [seg]

71

79

-

Iprscan [seg]

237

247

-

PDA4I6I5

81

129

S=172 I=57 E=2.19212e-13

PDA1G0P2

8

82

S=145 I=45 E=4.06086e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JeERjh80)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

39 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_1573496_1575136_f2_XFF4834R-XFF4834R_chr13750 XFF4834R_chr13750
XFF4834R_chr13740
XFF4834R_chr13740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13760
XFF4834R_chr13760
ID XFF4834R_chr_1573496_1575136_f2_XFF4834R-XFF4834R_chr13750
AC XFF4834R_chr13750
LT XFF4834R_chr13750
OR XFF4834R_chr from 1573496 to 1575136 on strand +
DE Putative plasmid mobilization protein
IP MobA/MobL protein
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro
Biological Process: unidirectional conjugation (GO:0009291)

Curated
PM
AN partial homology with other plasmid mobilization proteins in Xapf
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110707)
MW 60589.5 Da
SQ 546 aa
 
........10........20........30........40........50
| | | | |
MAIYHSHMKSFGRGKGDSSVAAAAYRAGFDLVDEATGLRHEYSRRYGVAF
AQMLAPKGSPNWCLDAEKFWNANEAAETRKNALVAREVEVALPQSLTDEQ
RKDLALSLGQLLVDRHQVAVLVAVHLPSRDGDRRNHHVHLLMSSRQVGPD
GFGERAGTEFDARQGEGTRAVRALRKEIAAEINRHLRKAGIQKTVDPRTL
QAQAREAAMKGDFERARELTRRPGKHMGKAKVALMRKTNFTAEVRGRGGA
DAAIALSNIVAAHMKASGTLVQPVPPSHSHAAALRDRSKAHSSSGGKRHL
AQPRARAAGHLQQIKERLARQAAPRPGLYTPYSGQARHLSKVTRLARSSG
RPDSEVLNAEAQLIEDWLEAQREVAQQSLEVLRQIPGIQIEPEFERAYAT
LVCRRVDSYPTKPFLFEDTEMLARSISKYAHTLVRPYKARMAVLDAQAKL
ADQQDNPDARVVARARQRVARAKLHVSPRIQAIQEWRIKKARKVMVEAAE
ALEKNFALQPIEVQPSVATVDEAPPPQVESEAGHWELKFRPPKPGF
XFF4834R

XFF4834R_chr32100 lcl|XFF4834R_chr34700026_3688624_r3_XFF4834R-XFF4834R_chr32100

1

241

S=554 I=49 E=2.03505e-60

XFF4834R

XFF4834R_chr13700 lcl|XFF4834R_chr_1570777_1571667_f1_XFF4834R-XFF4834R_chr13700

1

212

S=343 I=40 E=9.40818e-35

XFF4834R

NP_641841.1 lcl|mobL-XAC1507

1

511

S=1132 I=48 E=7.09617e-130

plasmid mobilization protein

XFF4834R

NP_643568.1 lcl|mobL-XAC3260

1

241

S=518 I=50 E=1.89918e-55

plasmid mobilization protein

XFF4834R

YP_362824.1 lcl|XCV1093

1

230

S=518 I=49 E=1.93259e-55

putative MobA/MobL family protein

XFF4834R

YP_362854.1 lcl|XCV1123

1

312

S=485 I=41 E=2.01197e-51

MobA/MobL family protein

XFF4834R

YP_365109.1 lcl|XCV3378

1

237

S=483 I=47 E=3.5771e-51

putative MobA/MobL family protein

XFF4834R

NP_641442.1 lcl|mobL-XAC1104

10

312

S=439 I=41 E=6.73182e-46

plasmid mobilization protein

XFF4834R

YP_361502.1 lcl|XCVb0008

1

241

S=336 I=39 E=2.16251e-33

MobA/MobL family plasmid mobilization protein

pubmed

1

206

S=427 I=42 E=9.86494e-43

ORF504 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

1

193

S=406 I=42 E=3.48668e-40

ORF237 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

1

199

S=364 I=40 E=3.75558e-35

TraA ; Plasmid

Pubmed 16672515

 

prodomImg

pubmed

1

199

S=361 I=41 E=8.0889e-35

TraA ; Plasmid

Pubmed 17158670,20118371

 

prodomImg

pubmed

1

234

S=352 I=37 E=1.03169e-33

Putative mobilization protein ; Plasmid

Pubmed 16828160

 

prodomImg

sp_Pdown

sp|P20085|MOBL_THIFE

1

161

S=286 I=39 E=6.77845e-26

Mobilization protein mobL ; Conjugation Mobility Plasmid

sp_Pdown

sp|Q44349|TRAA_AGRT5

1

153

S=176 I=32 E=1.53509e-12

Conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

sp_Pdown

sp|P55418|TRAA_RHISN

1

206

S=172 I=30 E=4.37033e-12

Probable conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

sp_Pdown

sp|Q8GN32|MOBA_BIFLO

1

153

S=172 I=31 E=5.38754e-12

Probable mobilization protein MobA ; Conjugation Mobility Plasmid

sp_Pdown

sp|Q44363|TRAA_RHIRD

1

155

S=154 I=30 E=7.10941e-10

Conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

Iprscan IPR005053 [PF03389]

18

207

MobA/MobL protein

Iprscan [seg]

459

472

-

PD674890

159

506

S=947 I=55 E=2.96597e-107

PDA1G0P2

5

86

S=198 I=52 E=1.61505e-16

PD007732

79

156

S=152 I=45 E=7.79346e-11

PDA9N8G1

509

546

S=104 I=61 E=4.71763e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NRNy1p5l)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

55 hits
swiss-prot

Swiss-Prot ncbi-blastp

6 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr13750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr34700026_3688624_r3_XFF4834R-XFF4834R_chr32100 XFF4834R_chr32100
XFF4834R_chr32090
XFF4834R_chr32090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32110
XFF4834R_chr32110
ID XFF4834R_chr34700026_3688624_r3_XFF4834R-XFF4834R_chr32100
AC XFF4834R_chr32100
LT XFF4834R_chr32100
OR XFF4834R_chr from 3687026 to 3688624 on strand -
DE putative MobA/MobL protein
IP MobA/MobL protein
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro
Biological Process: unidirectional conjugation (GO:0009291)

Curated
PM
AN Mobilization protein A (DNA strand transferase) /Mobilization protein mobB (Protein C)
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101103)
MW 59019 Da
SQ 532 aa
 
........10........20........30........40........50
| | | | |
MAIYHSRVKVFSRSRGDSAVAAAAYRGGLLLIDHLTGQRHDYRRRGGVVA
SECLAPEDAPAWALVPAELWPKAEEAENRKNSVVAREFEVALPHELNDEQ
RTELTMAIGQALVARYGFAVQASIHSPGSRDGLNHHVHLLATTRRLTSEG
FAEKTRELDGGASGKIEIEWIRQTIASTINGHLAAAGIDARVDHRRLEVQ
AEDALARGDWVEAMVLSRQPTKHMGKTATALARKGVMTERAAENARIVRE
NEEAFERLLAQAELEGRAAPNPTGHSHDQARRDRRRRAGSTNDLQSSVPG
LEIHGLRGMRLSDALGRPAEDARVRPLRPISELIAEAAQNLAEILSTRSD
LALTATQRVVRQWTSHAAALRDGVDLRRWLNGLVEGLGRLKRSVLKFAQG
MRNVGRAERLFHLAEQAWEQFNGDHPRPDGEWASQEWEKRRGRRLAVLEK
RTAELAAARAAVSEQHWNDYENEIEIRAAQVEQWSEEVLASPELAIASRS
IKSVKAAPAAPEPSPMPMPMPAPQPTRRRPRP
XFF4834R

XFF4834R_chr13750 lcl|XFF4834R_chr_1573496_1575136_f2_XFF4834R-XFF4834R_chr13750

1

238

S=554 I=49 E=1.97481e-60

XFF4834R

XFF4834R_chr13700 lcl|XFF4834R_chr_1570777_1571667_f1_XFF4834R-XFF4834R_chr13700

1

197

S=537 I=56 E=2.4093e-58

XFF4834R

NP_643568.1 lcl|mobL-XAC3260

1

505

S=2156 I=85 E=0

plasmid mobilization protein

XFF4834R

YP_362854.1 lcl|XCV1123

1

489

S=1073 I=50 E=1.02192e-122

MobA/MobL family protein

XFF4834R

YP_365109.1 lcl|XCV3378

1

489

S=1041 I=49 E=7.31273e-119

putative MobA/MobL family protein

XFF4834R

NP_641442.1 lcl|mobL-XAC1104

11

489

S=1009 I=49 E=6.39486e-115

plasmid mobilization protein

XFF4834R

NP_641841.1 lcl|mobL-XAC1507

1

280

S=532 I=43 E=3.77171e-57

plasmid mobilization protein

XFF4834R

YP_362824.1 lcl|XCV1093

1

270

S=446 I=44 E=9.18166e-47

putative MobA/MobL family protein

XFF4834R

YP_361502.1 lcl|XCVb0008

1

251

S=368 I=40 E=2.85555e-37

MobA/MobL family plasmid mobilization protein

pubmed

1

260

S=416 I=42 E=1.54651e-41

TraA ; Plasmid

Pubmed 16672515

 

prodomImg

pubmed

1

192

S=397 I=48 E=3.78999e-39

ORF237 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

1

201

S=396 I=46 E=4.59136e-39

ORF504 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

1

253

S=376 I=39 E=1.2277e-36

Putative mobilization protein ; Plasmid

Pubmed 16828160

 

prodomImg

pubmed

2

199

S=351 I=48 E=1.40795e-33

Mobilization protein ; Plasmid

Pubmed 12570988

 

prodomImg

pubmed

1

240

S=343 I=44 E=1.083e-32

TraA ; Plasmid

Pubmed 14702321

 

prodomImg

pubmed

1

240

S=338 I=41 E=4.68557e-32

TraA ; Plasmid

Pubmed 18413319

 

prodomImg

pubmed

1

253

S=336 I=37 E=7.90592e-32

MobA ; Plasmid

Pubmed 6368743,3011960

 

prodomImg

pubmed

1

200

S=325 I=40 E=1.99049e-30

TraA protein ; Plasmid

Pubmed 17881053

 

prodomImg

pubmed

1

252

S=300 I=34 E=1.85174e-27

RepB/MobA-like protein ; Plasmid

Pubmed 11400063

 

prodomImg

sp_Pdown

sp|P20085|MOBL_THIFE

1

266

S=254 I=34 E=4.53291e-22

Mobilization protein mobL ; Conjugation Mobility Plasmid

sp_Pdown

sp|Q44349|TRAA_AGRT5

1

234

S=214 I=32 E=3.21285e-17

Conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

sp_Pdown

sp|P55418|TRAA_RHISN

1

253

S=209 I=31 E=1.59811e-16

Probable conjugal transfer protein traA ; ATP-binding Conjugation Nucleotide-binding Plasmid

Iprscan [coil]

245

266

-

Iprscan IPR005053 [PF03389]

17

234

MobA/MobL protein

Iprscan [seg]

281

287

-

Iprscan [seg]

453

461

-

Iprscan [seg]

506

532

-

PD606449

251

489

S=598 I=52 E=7.21792e-65

PDA1G0P2

5

86

S=179 I=55 E=3.99361e-14

PD674890

164

326

S=151 I=31 E=1.11451e-10

PDA4I6I5

81

127

S=135 I=53 E=8.49138e-09

PD024358

126

241

S=135 I=35 E=9.84802e-09

PD007732

79

150

S=127 I=40 E=9.66971e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FSyzXLKi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr32100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr32100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr32100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_chr32100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00310044_0033646_r2_XFF4834R-XFF4834R_pla00410 XFF4834R_pla00410
XFF4834R_pla00400
XFF4834R_pla00400
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_pla00420
XFF4834R_pla00420
ID XFF4834R_pla00310044_0033646_r2_XFF4834R-XFF4834R_pla00410
AC XFF4834R_pla00410
LT XFF4834R_pla00410
OR XFF4834R_pla from 33044 to 33646 on strand -
DE putative lytic transglycosylase
IP Lytic transglycosylase-like, catalytic
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro


Curated
PM
AN for CL : 39% identity (on about 80% of the two sequences) with conjugal transfer protein TRWN in E.coli and signature prodom TRWN.
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100823)
MW 21230 Da
SQ 200 aa
 
........10........20........30........40........50
| | | | |
MEPIMSDLMSLILACSIGVHPQTVQAIITHESGGNPYAINNQARSFYPTR
LEDAQRIAVEQVRAGRSTDIGLMQINSQHLDKLGLTPIDLLDPCTNIRVG
TTILGQNYAQTWAKYRAEKPALLGALSMYNTGNESRGLRNGYVGWVSQAA
GVTVNLPSGVRVSGRRSTKAQSNAVSVVSPAAAPTGFAGTGPKAAKQGPR
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one yow7mKTA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

46 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00410.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00410.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00310627_0034163_r1_XFF4834R-XFF4834R_pla00420 XFF4834R_pla00420
XFF4834R_pla00410
XFF4834R_pla00410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_pla00430
XFF4834R_pla00430
ID XFF4834R_pla00310627_0034163_r1_XFF4834R-XFF4834R_pla00420
AC XFF4834R_pla00420
LT XFF4834R_pla00420
OR XFF4834R_pla from 33627 to 34163 on strand -
DE putative conjugal transfer protein TraF; peptidase
IP Peptidase S24/S26A/S26B/S26C
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: membrane (GO:0016020)
Molecular Function: serine-type peptidase activity (GO:0008236)

Curated
PM
AN better coding probability with ACUR matrix
CC COG: [OU] Posttranslational modification, protein turnover, chaperones;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 18857.4 Da
SQ 178 aa
 
........10........20........30........40........50
| | | | |
MAPALGWASARILSAFGFTVIANLSPSVAQGMYLLDRNVRSAERGQLVAF
PPHNAPARYGFERGWMKPGSLYIKRVGAIAGDTVCVNVEVTIATPTTPGH
PATFTRVGAVSATDHTGVPLPHALQGCHRVPAGHIFPIGDGLANSYDGRY
YGFVPVTLIAGRITPIWTQAQPDGADHE
pubmed

23

168

S=141 I=34 E=8.98431e-09

Tiorf110 protein ; Plasmid

Pubmed 10721727,9524202

 

prodomImg

pubmed

23

168

S=130 I=31 E=1.74139e-07

Conjugal transfer protein traF ; Conjugation Periplasm Plasmid Signal

Pubmed 8763953

 

prodomImg

pubmed

12

169

S=124 I=32 E=1.0961e-06

TraF ; Plasmid

Pubmed 20376355

 

prodomImg

pubmed

23

170

S=119 I=33 E=4.30854e-06

Riorf113 protein ; Plasmid

Pubmed 11273700,10907845

 

prodomImg

pubmed

17

170

S=113 I=29 E=1.93023e-05

Probable conjugal transfer protein TraF ; Plasmid

Pubmed 12591886

 

prodomImg

sp_Pdown

sp|Q44350|TRAF_AGRT5

23

168

S=130 I=31 E=1.1964e-07

Conjugal transfer protein traF ; Conjugation Periplasm Plasmid Signal

sp_Pdown

sp|P55417|TRAF_RHISN

23

170

S=111 I=31 E=2.29689e-05

Probable conjugal transfer protein traF ; Conjugation Periplasm Plasmid Signal

Iprscan IPR000223 [PR00727]

72

84

Peptidase S26A, signal peptidase I

Iprscan IPR000223 [PR00727]

130

149

Peptidase S26A, signal peptidase I

Iprscan IPR011056 [G3DSA:2.10.109.10]

38

171

Peptidase S24/S26A/S26B/S26C, beta-ribbon domain

Iprscan [PTHR12383:SF2]

67

163

-

Iprscan [PTHR12383]

67

163

-

Iprscan IPR019533 [PF10502]

21

168

Peptidase S26, conserved region

Iprscan [SignalP-NN(euk)]

1

31

-

Iprscan [tmhmm]

12

34

-

PD854894

32

167

S=127 I=31 E=6.42029e-08

PD010845

20

128

S=109 I=34 E=9.8258e-06

Iprscan IPR015927 [SSF51306]

38

167

Peptidase S24/S26A/S26B/S26C

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one i1WepUAS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_pla00420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plb00150146_0018874_r2_XFF4834R-XFF4834R_plb00190 XFF4834R_plb00190
XFF4834R_plb_0021
XFF4834R_plb_0021
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plb00200
XFF4834R_plb00200
ID XFF4834R_plb00150146_0018874_r2_XFF4834R-XFF4834R_plb00190
AC XFF4834R_plb00190
LT XFF4834R_plb00190
OR XFF4834R_plb from 18146 to 18874 on strand -
DE putative protein TraL
IP
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120313)
MW 27056.6 Da
SQ 242 aa
 
........10........20........30........40........50
| | | | |
MQNTIHFILQGKGGIGKSFIAVMLAQFFKSKGADLKAFDTDQENTTFAHY
KALGAQHIPVMNESRTIDAKRFDALMEKLLTEDGTFVIDNGANTFSPLLA
YMVENNVISFLNENDKKVYLHTVVGGGDTLADTANGFNSIAQGIEDAPVV
LWLNEHFGPMKTDEGKDFTDTKVFKANQSRLHGVVSLQARNHQTYGDDIK
KMNTKRLTVDEIMQSPDFALMEKQRIRNVAKDVFGQLDKIEF
pubmed

5

238

S=492 I=42 E=3.315e-51

TraL ; Plasmid

Pubmed 15489427

 

prodomImg

pubmed

5

238

S=467 I=40 E=3.93663e-48

TraL ; Plasmid

Pubmed 15580337,16517619

 

prodomImg

pubmed

5

238

S=465 I=40 E=6.93822e-48

TraL ; Plasmid

Pubmed 16445980

 

prodomImg

pubmed

5

238

S=464 I=41 E=9.8335e-48

TraL

Pubmed 11923356

 

prodomImg

pubmed

5

238

S=460 I=39 E=2.5658e-47

TraL protein ; Plasmid

Pubmed 17132149

 

prodomImg

pubmed

5

238

S=460 I=40 E=3.21864e-47

TraL protein ; Plasmid

Pubmed 12589432

 

prodomImg

pubmed

5

238

S=454 I=39 E=1.49313e-46

TraL origin of transfer (OriT) protein ; Plasmid

Pubmed 15528648

 

prodomImg

pubmed

5

238

S=454 I=39 E=1.49313e-46

TraL protein ; Plasmid

Pubmed 16122561

 

prodomImg

pubmed

5

238

S=454 I=39 E=1.49313e-46

TraL protein ; Plasmid

Pubmed 16980416

 

prodomImg

pubmed

5

238

S=453 I=40 E=2.2105e-46

TraL protein ; Plasmid

Pubmed 8014987,17320955

 

prodomImg

sp_Pdown

sp|Q00188|TRAL4_ECOLX

5

238

S=453 I=40 E=1.52558e-46

Protein traL ; Conjugation Plasmid

sp_Pdown

sp|Q00187|TRAL5_ECOLX

5

238

S=453 I=39 E=1.57973e-46

Protein traL ; Conjugation Plasmid

PD987744

81

240

S=387 I=46 E=2.13569e-39

PD038621

4

41

S=128 I=61 E=4.64145e-08

PD463914

2

156

S=110 I=26 E=6.68285e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one EamgE4vA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plb00150884_0019273_r2_XFF4834R-XFF4834R_plb00200 XFF4834R_plb00200
XFF4834R_plb00190
XFF4834R_plb00190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plb00010
XFF4834R_plb00010
ID XFF4834R_plb00150884_0019273_r2_XFF4834R-XFF4834R_plb00200
AC XFF4834R_plb00200
LT XFF4834R_plb00200
OR XFF4834R_plb from 18884 to 19273 on strand -
DE putative TraD protein
IP
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro


Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 13834.5 Da
SQ 129 aa
 
........10........20........30........40........50
| | | | |
MTKTSVADVLRELAKGENSRSETARLRDVIDEVEAAIAAGVSRSAVLKAL
HGQGFTMTLKSFESALYRIRKQRGQGAAAAPIAPPTTPLRHDEQGGEVAS
AASKKAGDFEIPVPKRFTHNPKPDDDLLK
XFF4834R

XFF4834R_plc00150 lcl|XFF4834R_plc00080215_0009661_r1_XFF4834R-XFF4834R_plc00150

21

76

S=111 I=39 E=1.47115e-07

XFF4834R

YP_361530.1 lcl|XCVc0014

21

72

S=110 I=40 E=7.14865e-07

putative TraD protein

XFF4834R

NP_644752.1 lcl|XACb0024-XACb0024

20

72

S=96 I=38 E=3.31349e-05

hypothetical protein

XFF4834R

NP_644699.1 lcl|XACa0013-XACa0013

20

72

S=96 I=38 E=3.31349e-05

hypothetical protein

pubmed

8

71

S=145 I=45 E=1.13443e-09

Putative uncharacterized protein ; Plasmid

Pubmed 15262947

 

prodomImg

pubmed

20

75

S=131 I=43 E=6.83024e-08

YciA protein ; Plasmid

Pubmed 1400257

 

prodomImg

Iprscan [seg]

77

88

-

PD538578

1

73

S=179 I=45 E=2.81625e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one abWcf3i4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plb00200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plc00150
XFF4834R_plc00140
XFF4834R_plc00140
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc00160
XFF4834R_plc00160
ID
AC XFF4834R_plc00150
LT XFF4834R_plc00150
OR XFF4834R_plc from 8215 to 8661 on strand -
DE Putative plasmid transfer protein TraD
IP
CL 8.2.2 plasmid transfer GO:0009291
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 16276.1 Da
SQ 148 aa
 
........10........20........30........40........50
| | | | |
MDVDVNKLKQSITELTGGTKAAKLRRVMPEIEEKLDQGVRHEEIVAALHA
GGLDVTLETFRKTLYRYRAQRAGGTKETPPKAVRATTADGNPQVRADAPT
EDLTADDAAGDAPTSTSFDDALDRRKRDQVGESYLTRRKPIIGKKRTT
XFF4834R

XFF4834R_plb00200 lcl|XFF4834R_plb00150884_0019273_r2_XFF4834R-XFF4834R_plb00200

19

74

S=111 I=39 E=1.86478e-07

XFF4834R

XFF4834R_chr42480 lcl|XFF4834R_chr_4929380_4929763_r3_XFF4834R-XFF4834R_chr42480

24

76

S=109 I=42 E=3.64912e-07

XFF4834R

lcl|stbA-XALq_3212

1

148

S=534 I=79 E=4.00859e-58

putative stable plasmid inheritance protein

XFF4834R

YP_361530.1 lcl|XCVc0014

9

114

S=148 I=36 E=2.07541e-11

putative TraD protein

XFF4834R

NP_644752.1 lcl|XACb0024-XACb0024

8

76

S=142 I=43 E=1.23976e-10

hypothetical protein

XFF4834R

NP_644699.1 lcl|XACa0013-XACa0013

8

76

S=142 I=43 E=1.23976e-10

hypothetical protein

pubmed

19

145

S=234 I=45 E=3.12611e-20

StbA ; Plasmid

Pubmed 18268088

 

prodomImg

pubmed

19

145

S=234 I=45 E=3.1811e-20

Putative uncharacterized protein ; Plasmid

Pubmed 14645321

 

prodomImg

pubmed

19

145

S=233 I=45 E=3.26541e-20

Conserved hypothetical plasmid protein

Pubmed 18268088

 

prodomImg

pubmed

19

145

S=227 I=44 E=1.85119e-19

StbA ; Plasmid

Pubmed 18268088

 

prodomImg

pubmed

19

145

S=221 I=43 E=1.17541e-18

Putative uncharacterized protein ; Plasmid

Pubmed 16391056,7022127

 

prodomImg

pubmed

19

87

S=147 I=46 E=9.71427e-10

Putative TraD protein ; Plasmid

Pubmed 12534468

 

prodomImg

pubmed

19

78

S=145 I=48 E=1.8358e-09

Putative plasmid transfer protein TraD

Pubmed 16707697,2175388

 

prodomImg

pubmed

19

94

S=137 I=37 E=1.59543e-08

Putative TraD protein ; Plasmid

Pubmed 15288784

 

prodomImg

pubmed

19

94

S=137 I=37 E=1.59543e-08

Putative TraD protein ; Plasmid

Pubmed 10719200

 

prodomImg

pubmed

19

72

S=121 I=44 E=1.53818e-06

YciA protein ; Plasmid

Pubmed 1400257

 

prodomImg

PD538578

19

71

S=138 I=47 E=3.14437e-09

PDA4O2L0

24

121

S=107 I=30 E=1.58758e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qChgtVOt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plc00150.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plc00150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plc00150.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkWj5Qy/XFF4834R_plc00150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.