Xanthomonas fuscans subsp. fuscans

10 hits

  1. XFF4834R_chr42420XFF4834R_chr_4924899_4926086_f3_XFF4834R-XFF4834R_chr42420XFF4834R_chr42420putative zeta toxin of the postsegregational killing system
  2. XFF4834R_chr42510XFF4834R_chr_4930931_4931224_f2_XFF4834R-XFF4834R_chr42510XFF4834R_chr42510putative plasmid stabilisation system protein
  3. XFF4834R_pla00180XFF4834R_pla00110109_0012363_f1_XFF4834R-XFF4834R_pla00180XFF4834R_pla00180putative plasmid stability protein
  4. XFF4834R_pla00190XFF4834R_pla00110360_0012776_f3_XFF4834R-XFF4834R_pla00190XFF4834R_pla00190putative plasmid stability protein
  5. XFF4834R_pla00450XFF4834R_pla00450Putative plasmid partitioning protein
  6. XFF4834R_plb00030XFF4834R_plb00030Putative plasmid partitioning protein
  7. XFF4834R_plb00100XFF4834R_plb00100Putative replication protein RepA
  8. XFF4834R_plc00140StbBXFF4834R_plc00140probable plasmid stability protein
  9. XFF4834R_plc00400XFF4834R_plc00400Putative replication protein
  10. XFF4834R_plc00420XFF4834R_plc_0036006_0036590_f3_XFF4834R-XFF4834R_plc00420XFF4834R_plc00420Probable KrfA protein

XFF4834R_chr_4924899_4926086_f3_XFF4834R-XFF4834R_chr42420 XFF4834R_chr42420
XFF4834R_chr42410
XFF4834R_chr42410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42430
XFF4834R_chr42430
ID XFF4834R_chr_4924899_4926086_f3_XFF4834R-XFF4834R_chr42420
AC XFF4834R_chr42420
LT XFF4834R_chr42420
OR XFF4834R_chr from 4924899 to 4926086 on strand +
DE putative zeta toxin of the postsegregational killing system
IP
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro


Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 45701.9 Da
SQ 395 aa
 
........10........20........30........40........50
| | | | |
MDDNRFQLSPRKHATIYEKIERHQFKDTAPTDQPQAIILGGQPGAGKSGL
LEASKQGFADRNVVTINGDELRYYHPQYLAIQKADERHFAELTDPHARPW
TKQLFDRTIETRRNVVFEGTMRESGPITETMRRLKAAGYYVVARVIAANE
RDSMAGIHRRYEEQKAAKGFGRWSNVQAHDDAYKGMPATLEYIERHKLAD
RVQVYDRKGNVLYDNELHGNEWKRQPVARAAIEAERERPPTPEERRQHEA
EWATILAMMAARRADEREIERVRDVARQYGGQQYPEHKPAEYERQDYGRQ
HPELRAPETGKTYQGPIVSADDKYVIQSVRKAGRELHIQHERLVLNSDRR
ELLNTGANVEIRYPYNRVGIVKEWGEKAIQGPASKGIEPRDFGKR
XFF4834R

YP_361658.1 lcl|XCVd0099

1

395

S=1712 I=83 E=0

putative zeta toxin of the postsegregational killing system

XFF4834R

NP_644785.1 lcl|XACb0057-XACb0057

1

395

S=1712 I=83 E=0

hypothetical protein

XFF4834R

NP_638807.2 lcl|XCC3461

1

215

S=261 I=29 E=1.87804e-24

hypothetical protein

pubmed

6

225

S=358 I=34 E=1.45497e-34

Putative uncharacterized protein ; Plasmid

Pubmed 9742696,9465390

 

prodomImg

pubmed

31

215

S=230 I=31 E=4.91261e-19

Zeta-toxin ; ATP-binding Nucleotide-binding Plasmid

Pubmed 12195739

 

prodomImg

pubmed

32

215

S=226 I=31 E=1.41085e-18

Toxin of epsilon-zeta postsegregational killing system ; Plasmid

Pubmed 8093174

 

prodomImg

pubmed

32

215

S=226 I=31 E=1.41085e-18

Zeta-toxin ; ATP-binding Nucleotide-binding Plasmid

Pubmed 8293991,8093174

 

prodomImg

pubmed

32

215

S=224 I=31 E=2.16281e-18

Zeta toxin ; Plasmid

Pubmed 18511120

 

prodomImg

sp_Pdown

sp|Q93CM1|ZTOX_ENTHR

31

215

S=230 I=31 E=3.34086e-19

Zeta-toxin ; ATP-binding Nucleotide-binding Plasmid

sp_Pdown

sp|Q54944|ZTOX_STRPY

32

215

S=226 I=31 E=9.59456e-19

Zeta-toxin ; ATP-binding Nucleotide-binding Plasmid

sp_Pdown

sp|P0A4M2|ZTOX_STRAG

26

215

S=223 I=30 E=2.17749e-18

Zeta-toxin ; ATP-binding Nucleotide-binding Plasmid

sp_Pdown

sp|P0A4M1|ZTOX_ENTFA

26

215

S=223 I=30 E=2.17749e-18

Zeta-toxin ; ATP-binding Nucleotide-binding Plasmid

Iprscan [G3DSA:3.40.50.300]

2

298

-

Iprscan [PF06414]

22

217

-

Iprscan [seg]

226

246

-

Iprscan [seg]

257

277

-

PD359515

20

225

S=491 I=49 E=5.23297e-52

PD604836

279

395

S=247 I=48 E=1.93895e-22

PD420755

1

147

S=208 I=35 E=9.86715e-18

PD894853

1

32

S=129 I=75 E=3.12272e-08

PDA9E307

169

215

S=109 I=40 E=1.01155e-05

Iprscan [SSF52540]

32

244

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uMsJfyHB)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4930931_4931224_f2_XFF4834R-XFF4834R_chr42510 XFF4834R_chr42510
XFF4834R_chr42500
XFF4834R_chr42500
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42520
XFF4834R_chr42520
ID XFF4834R_chr_4930931_4931224_f2_XFF4834R-XFF4834R_chr42510
AC XFF4834R_chr42510
LT XFF4834R_chr42510
OR XFF4834R_chr from 4930931 to 4931224 on strand +
DE putative plasmid stabilisation system protein
IP Plasmid stabilization system
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101004)
MW 11068.6 Da
SQ 97 aa
 
........10........20........30........40........50
| | | | |
MKVRWIAAARQDRADIIDYIAVETPRAALKMDDLFSEAAKRLGEFPKLGC
TGKIPGTRELIPHESYRLVYEVDEAADTVWVMTLIHTARQWPPARDD
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr42580 lcl|XFF4834R_chr_4940252_4940536_r3_XFF4834R-XFF4834R_chr42580

23

96

S=188 I=49 E=4.00843e-17

XFF4834R

XFF4834R_plb00080 lcl|XFF4834R_plb_0006284_0006592_f2_XFF4834R-XFF4834R_plb00080

42

92

S=97 I=41 E=4.60633e-06

XFF4834R

XFF4834R_chr41860 lcl|XFF4834R_chr_4867768_4868874_f1_XFF4834R-XFF4834R_chr41860

24

76

S=88 I=41 E=5.43171e-05

XFF4834R

YP_361533.1 lcl|XCVc0017

22

97

S=403 I=100 E=1.25956e-42

putative plasmid stabilisation system protein

pubmed

23

96

S=266 I=66 E=1.46587e-24

Plasmid stabilization protein ParE

Pubmed 16122561

 

prodomImg

pubmed

31

95

S=242 I=71 E=1.1159e-21

RE protein ; Plasmid

Pubmed 18591274

 

prodomImg

pubmed

27

92

S=142 I=39 E=1.84789e-09

YacB ; Plasmid

Pubmed 16251312

 

prodomImg

pubmed

27

92

S=139 I=38 E=3.98006e-09

YacB ; Plasmid

Pubmed 19202093

 

prodomImg

pubmed

27

92

S=138 I=38 E=4.65636e-09

YacB ; Plasmid

Pubmed 16885466

 

prodomImg

Iprscan IPR007712 [PF05016]

3

91

Plasmid stabilisation system

PD066027

40

92

S=132 I=45 E=1.45115e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wcjAyzkG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_chr42510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00110109_0012363_f1_XFF4834R-XFF4834R_pla00180 XFF4834R_pla00180
XFF4834R_pla_0016
XFF4834R_pla_0016
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_pla00190
XFF4834R_pla00190
ID XFF4834R_pla00110109_0012363_f1_XFF4834R-XFF4834R_pla00180
AC XFF4834R_pla00180
LT XFF4834R_pla00180
OR XFF4834R_pla from 12109 to 12363 on strand +
DE putative plasmid stability protein
IP
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro


Curated
PM
AN This CDS is included in the PCR fragment amplified with the primer X4e (position 11774 to 11796 on plasmid 1) the primer X4c (position 12586 to 12563 on plasmid 1) described by Audy et al 1994, and that allows with the specific dectection of phaseoli by PCR.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120930)
MW 9388.7 Da
SQ 84 aa
 
........10........20........30........40........50
| | | | |
MAMLTVRNLPDDVHRALRMRAAQNGHSTEAEVREILATAVKPETRVRLGE
ALAALGRKIGLTNEDFEVFDRVRDKTPAVPPRLE
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr42630 lcl|XFF4834R_chr_4945220_4945474_f2_XFF4834R-XFF4834R_chr42630

1

84

S=423 I=100 E=9.43857e-46

XFF4834R

NP_644608.1 lcl|Y4JJ-XAC4314

1

84

S=213 I=52 E=8.66657e-20

plasmid stability protein

pubmed

1

78

S=200 I=51 E=1.49185e-16

Plasmid stability protein stbC

Pubmed 9326365

 

prodomImg

pubmed

1

60

S=136 I=47 E=9.09454e-09

Trafficking protein A

Pubmed 10639460

 

prodomImg

sp_Pdown

sp|P55510|Y4JJ_RHISN

1

84

S=233 I=58 E=1.06732e-20

Putative plasmid stability protein y4jJ

sp_Pdown

sp|Q52561|STBC_PSESM

1

78

S=200 I=51 E=9.33353e-17

Plasmid stability protein stbC

PD028753

1

43

S=162 I=77 E=3.99658e-12

PD218520

45

84

S=111 I=60 E=4.90217e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LPQ3kpXg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00110360_0012776_f3_XFF4834R-XFF4834R_pla00190 XFF4834R_pla00190
XFF4834R_pla00180
XFF4834R_pla00180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_pla00200
XFF4834R_pla00200
ID XFF4834R_pla00110360_0012776_f3_XFF4834R-XFF4834R_pla00190
AC XFF4834R_pla00190
LT XFF4834R_pla00190
OR XFF4834R_pla from 12360 to 12776 on strand +
DE putative plasmid stability protein
IP PilT protein, N-terminal
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro


Curated
PM
AN This gene includes the primer X4c (position 12586 to 12563 on plasmid 1) described by Audy et al 1994, and that allows with the primer X4e (position 11774 to 11796 on plasmid 1) the specific dectection of phaseoli by PCR.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120930)
MW 14832.8 Da
SQ 138 aa
 
........10........20........30........40........50
| | | | |
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAAL
PAGKRKDMLEQALDGLMGLFRDRVLPFDIDAARRYAELAVTAKIGGRGFP
TPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
XFF4834R

XFF4834R_chr42640 lcl|XFF4834R_chr_4945471_4945755_f1_XFF4834R-XFF4834R_chr42640

1

47

S=249 I=100 E=3.01473e-24

XFF4834R

NP_644609.1 lcl|Y4JK-XAC4315

1

136

S=316 I=51 E=1.02497e-31

plasmid stability protein

XFF4834R

YP_361660.1 lcl|XCVd0101

3

132

S=136 I=34 E=6.56439e-10

hypothetical protein

XFF4834R

NP_644787.1 lcl|vapC-XACb0059

3

132

S=136 I=34 E=6.56439e-10

virulence associated protein

pubmed

1

138

S=370 I=52 E=7.23096e-37

Plasmid stability protein stbB

Pubmed 9326365

 

prodomImg

pubmed

1

137

S=303 I=45 E=1.02693e-28

Trafficking protein B

Pubmed 10639460

 

prodomImg

pubmed

21

132

S=207 I=42 E=4.14171e-17

DNA capable of inhibiting gonococcal transformation, clone pGCU22.

Pubmed 3137581

 

prodomImg

pubmed

3

138

S=191 I=36 E=4.20753e-15

Putative plasmid stability-like protein

Pubmed 16237001

 

prodomImg

pubmed

3

136

S=150 I=34 E=3.58143e-10

Plasmid stability-like protein

Pubmed 9353917

 

prodomImg

pubmed

1

126

S=133 I=30 E=3.73477e-08

Putative virulence associated protein C Putative virulence-associated protein C

Pubmed 18226230

 

prodomImg

pubmed

3

136

S=119 I=32 E=1.99026e-06

MvpA protein Plasmid maintenance protein Putative STBORF2

Pubmed 11115111

 

prodomImg

pubmed

3

136

S=118 I=32 E=2.65378e-06

MvpA ; Plasmid

Pubmed 14573649

 

prodomImg

pubmed

3

136

S=117 I=32 E=3.66408e-06

Putative post-segregational-killing anti-toxin ; Plasmid

Pubmed 16926437

 

prodomImg

sp_Pdown

sp|P55511|Y4JK_RHISN

1

137

S=394 I=55 E=7.06828e-40

Putative plasmid stability protein y4jK

sp_Pdown

sp|Q52562|STBB_PSESM

1

138

S=370 I=52 E=4.97469e-37

Plasmid stability protein stbB

Iprscan IPR002716 [PF01850]

2

135

PilT protein, N-terminal

PD688407

1

39

S=133 I=62 E=1.03336e-08

PD915843

40

99

S=101 I=56 E=7.65705e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CCM2ytIC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00450
XFF4834R_pla00440
XFF4834R_pla00440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_pla_0047
XFF4834R_pla_0047
ID
AC XFF4834R_pla00450
LT XFF4834R_pla00450
OR XFF4834R_pla from 35364 to 36002 on strand -
DE Putative plasmid partitioning protein
IP Cobyrinic acid a,c-diamide synthase
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro
Biological Process: cobalamin biosynthetic process (GO:0009236)
c-diamide synthase activity (GO:0042242)

Curated
PM
AN
CC COG: [D] Cell cycle control, cell division, chromosome partitioning;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101121)
MW 21769.5 Da
SQ 212 aa
 
........10........20........30........40........50
| | | | |
MKTVAIAVQKGGAGKTTIAVHLAVAAQQAGLRVALADTDPQGSAKAWAET
RSDSTLEVVAITSANVGAAVAAAAEEGYDLLIVDTPPHASAGIAAALEHA
DLALMPVRPSLLDLAAAPASIRLLHASGKPGAFILSSAPIRASETREIER
ELANTGIPVLETVIHDRTAYRRALAHGQAVGEFEPAGKAAFEVRALWREV
NTLLGATKGTHA
XFF4834R

XFF4834R_plb00030 lcl|XFF4834R_plb00030087_0003716_f3_XFF4834R-XFF4834R_plb00030

1

204

S=253 I=35 E=2.03171e-24

XFF4834R

XFF4834R_chr42750 lcl|XFF4834R_chr_4952141_4952770_f2_XFF4834R-XFF4834R_chr42750

9

196

S=217 I=32 E=4.51616e-20

XFF4834R

XFF4834R_chr01590 lcl|XFF4834R_chr01750622_0197254_f2_XFF4834R-XFF4834R_chr01590

1

107

S=172 I=44 E=1.43404e-14

XFF4834R

XFF4834R_chr42390 lcl|XFF4834R_chr_4923584_4924216_f2_XFF4834R-XFF4834R_chr42390

4

187

S=155 I=33 E=1.64596e-12

XFF4834R

XFF4834R_chr37920 lcl|XFF4834R_chr41010721_4383518_f3_XFF4834R-XFF4834R_chr37920

2

44

S=106 I=56 E=1.28298e-06

XFF4834R

lcl|parA-XALp_3174

1

206

S=384 I=38 E=9.83274e-40

probable plasmid partitioning protein

XFF4834R

YP_361515.1 lcl|parA-XCVb0021

1

201

S=270 I=35 E=6.73851e-26

plasmid partitioning-family protein

XFF4834R

NP_644727.1 lcl|parA-XACa0041

9

200

S=210 I=31 E=1.12054e-18

partition protein A

XFF4834R

NP_640548.1 lcl|parA-XAC0192

1

107

S=172 I=44 E=5.27201e-14

partition protein

XFF4834R

YP_361906.1 lcl|XCV0175

1

186

S=170 I=32 E=7.94222e-14

ParA family partition protein

XFF4834R

NP_635569.1 lcl|parA-XCC0174

1

107

S=166 I=43 E=2.69186e-13

partition protein

XFF4834R

NP_644747.1 lcl|parA-XACb0019

10

200

S=127 I=30 E=1.41848e-08

partition protein A

XFF4834R

NP_644704.1 lcl|parA-XACa0018

10

200

S=127 I=30 E=1.41848e-08

partition protein A

XFF4834R

YP_361521.1 lcl|XCVc0005

10

200

S=127 I=30 E=1.44344e-08

putative partition protein

XFF4834R

NP_644782.1 lcl|parA-XACb0054

1

59

S=113 I=41 E=7.49349e-07

partition protein A

pubmed

1

197

S=343 I=41 E=3.16839e-33

Putative MinD/ParA family ATPase ; Plasmid

Pubmed 18227089

 

prodomImg

pubmed

1

207

S=272 I=36 E=1.46003e-24

ParA partitioning protein ; Plasmid

Pubmed 15995187

 

prodomImg

pubmed

1

207

S=272 I=36 E=1.46003e-24

Partitioning protein A ; Plasmid

Pubmed 17261525

 

prodomImg

pubmed

1

204

S=271 I=34 E=1.98102e-24

ATPase ; Plasmid

Pubmed 16165318

 

prodomImg

pubmed

1

207

S=270 I=36 E=2.25781e-24

ParA ; Plasmid

Pubmed 9742696,9465390

 

prodomImg

pubmed

1

204

S=267 I=37 E=5.63988e-24

Partitioning protein ; Plasmid

Pubmed 19273683

 

prodomImg

pubmed

1

204

S=256 I=36 E=1.2678e-22

ORF209 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

2

199

S=245 I=34 E=2.90006e-21

Partitioning protein

Pubmed 18448537

 

prodomImg

pubmed

1

196

S=242 I=34 E=5.24675e-21

Plasmid partitioning protein-like

Pubmed 16697042

 

prodomImg

pubmed

1

187

S=232 I=35 E=9.40206e-20

ParA ; Plasmid

Pubmed 14702321

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

2

200

-

Iprscan IPR002586 [PF01656]

4

172

Cobyrinic acid a,c-diamide synthase

Iprscan [seg]

66

77

-

Iprscan [seg]

109

120

-

PD860547

129

197

S=117 I=43 E=9.54685e-07

PD000159

1

44

S=104 I=54 E=4.31085e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gMYqLWWU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

102 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_pla00450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plb00030
XFF4834R_plb00020
XFF4834R_plb00020
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plb00040
XFF4834R_plb00040
ID
AC XFF4834R_plb00030
LT XFF4834R_plb00030
OR XFF4834R_plb from 3087 to 3716 on strand +
DE Putative plasmid partitioning protein
IP Cobyrinic acid a,c-diamide synthase
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro
Biological Process: cobalamin biosynthetic process (GO:0009236)
c-diamide synthase activity (GO:0042242)

Curated
PM
AN
CC COG: [D] Cell cycle control, cell division, chromosome partitioning;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101121)
MW 22073 Da
SQ 209 aa
 
........10........20........30........40........50
| | | | |
MQVIAVLNQKGGSGKTTIATHLARVLQLDGADVLLVDSDPQGSARDWAAV
REDQPVTVVGIDRPTIDRDLKNVARKDFVVIDGAPQAADLAVSAIKAANF
VLIPVQPSPYDIWATADLVELVKQRIEVTDGKLQAAFVVSRAIKGTRIGA
EVTDALNGYGLPVLQARITQRVSYPGTAAAGSTVMDAEPDGDAAAEVRAL
ANEIKQKLI
XFF4834R

XFF4834R_chr42750 lcl|XFF4834R_chr_4952141_4952770_f2_XFF4834R-XFF4834R_chr42750

3

200

S=471 I=50 E=7.20472e-51

XFF4834R

XFF4834R_pla00450 lcl|XFF4834R_pla00340364_0036002_r1_XFF4834R-XFF4834R_pla00450

1

208

S=277 I=37 E=2.87676e-27

XFF4834R

XFF4834R_chr01590 lcl|XFF4834R_chr01750622_0197254_f2_XFF4834R-XFF4834R_chr01590

1

186

S=160 I=32 E=3.75832e-13

XFF4834R

XFF4834R_chr20530 lcl|XFF4834R_chr22270813_2374595_r2_XFF4834R-XFF4834R_chr20530

1

43

S=99 I=51 E=9.74923e-06

XFF4834R

XFF4834R_chr37920 lcl|XFF4834R_chr41010721_4383518_f3_XFF4834R-XFF4834R_chr37920

2

44

S=99 I=56 E=1.00952e-05

XFF4834R

NP_644727.1 lcl|parA-XACa0041

7

206

S=476 I=51 E=6.79003e-51

partition protein A

XFF4834R

YP_361515.1 lcl|parA-XCVb0021

1

208

S=245 I=33 E=6.86852e-23

plasmid partitioning-family protein

XFF4834R

lcl|parA-XALp_3174

1

204

S=228 I=31 E=8.23482e-21

probable plasmid partitioning protein

XFF4834R

YP_361521.1 lcl|XCVc0005

3

206

S=161 I=32 E=9.48688e-13

putative partition protein

XFF4834R

YP_361906.1 lcl|XCV0175

1

186

S=161 I=32 E=1.211e-12

ParA family partition protein

XFF4834R

NP_640548.1 lcl|parA-XAC0192

1

186

S=160 I=32 E=1.3802e-12

partition protein

XFF4834R

NP_635569.1 lcl|parA-XCC0174

1

186

S=159 I=32 E=2.02558e-12

partition protein

XFF4834R

NP_644747.1 lcl|parA-XACb0019

3

204

S=151 I=30 E=1.9889e-11

partition protein A

XFF4834R

NP_644704.1 lcl|parA-XACa0018

3

204

S=151 I=30 E=1.9889e-11

partition protein A

XFF4834R

lcl|XALc_1373

1

59

S=110 I=45 E=1.84718e-06

putative chromosome partitioning protein

pubmed

1

209

S=987 I=92 E=2.74487e-111

Partitioning protein ; Plasmid

Pubmed 19273683

 

prodomImg

pubmed

1

209

S=918 I=91 E=7.6283e-103

ParA ; Plasmid

Pubmed 14702321

 

prodomImg

pubmed

1

208

S=891 I=82 E=1.36469e-99

ParA partitioning protein ; Plasmid

Pubmed 15995187

 

prodomImg

pubmed

1

208

S=891 I=82 E=1.36469e-99

Partitioning protein A ; Plasmid

Pubmed 17261525

 

prodomImg

pubmed

1

208

S=890 I=82 E=1.88424e-99

ParA ; Plasmid

Pubmed 9742696,9465390

 

prodomImg

pubmed

1

205

S=889 I=83 E=2.4263e-99

ORF209 ; Plasmid

Pubmed 16269793

 

prodomImg

pubmed

2

206

S=526 I=57 E=2.01658e-55

ParA protein

Pubmed 19286788

 

prodomImg

pubmed

2

203

S=504 I=55 E=1.18182e-52

Partitioning protein

Pubmed 18448537

 

prodomImg

pubmed

2

172

S=457 I=54 E=5.85403e-47

ORF58

Pubmed 12452967

 

prodomImg

pubmed

3

186

S=439 I=48 E=7.52555e-45

Partition protein ; Plasmid

Pubmed 18413319

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

2

204

-

Iprscan IPR002586 [PF01656]

4

123

Cobyrinic acid a,c-diamide synthase

PD530901

127

191

S=189 I=58 E=1.80924e-15

PDA1H218

46

86

S=144 I=72 E=5.08484e-10

PDA1K9P9

1

28

S=131 I=93 E=2.39835e-08

PDA1H0B9

90

123

S=125 I=68 E=1.14208e-07

PD451937

130

204

S=117 I=34 E=1.02777e-06

PDA1V2R9

133

208

S=111 I=32 E=5.43398e-06

PD000159

1

58

S=109 I=45 E=9.66112e-06

PDA8T3Q0

94

208

S=106 I=30 E=2.2118e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BW9FIzDi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

108 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plb00100
XFF4834R_plb00090
XFF4834R_plb00090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plb00110
XFF4834R_plb00110
ID
AC XFF4834R_plb00100
LT XFF4834R_plb00100
OR XFF4834R_plb from 7121 to 8398 on strand +
DE Putative replication protein RepA
IP Plasmid encoded RepA protein
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 46214.6 Da
SQ 425 aa
 
........10........20........30........40........50
| | | | |
MTMADASKNPQGQTALDLGDTADTARDAFDETAYRNQMIAAGISIKDATD
VAAKTAAARRGQPMRGTASTRSRVRGSDSQVKEQPPAGSFSPIGALLGGI
LPPAVKKTGERIAYAAEKATPAQKAKAGRAAVLSEQERKLLDKATTIASV
PPTGEDMAFTHAVLCQVGLPRAKIEAREFMRQSGAAWINVQAGWLDEGRG
PVQQPVPYGVMPRLALAWVSSYAKRHNTREIPIGDSAAEFLRLMLGEDTV
AQGARHATLRKQMHALAACRLQLGFKGRTFNGQPVEQFDAWLSNRDAPQR
PLWPGVMTLSEHYFNELQNSAVPLDNRALHALKGSALALDVYCWLAHRLH
RIEGKGVTLHWKSIREQFAQEYKGKDPDKDFKKEFLPVLRKVQAVYPAAN
VKQVTGGLLLIGSPPPIPKLPKGLK
Show or not Domain decomposition
 
XFF4834R

NP_642756.1 lcl|repA-XAC2441

117

405

S=993 I=69 E=3.87675e-113

replication protein

XFF4834R

YP_361657.1 lcl|XCVd0098

117

405

S=792 I=52 E=1.03565e-88

putative replication protein A

XFF4834R

NP_644784.1 lcl|repA-XACb0056

117

405

S=788 I=52 E=2.82267e-88

replication protein A

pubmed

132

405

S=1162 I=78 E=5.19188e-132

RepA ; Plasmid

Pubmed 14702321

 

prodomImg

pubmed

112

405

S=1128 I=74 E=6.2687e-128

Probable RepA ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

109

405

S=1075 I=72 E=1.65611e-121

Replication protein ; Plasmid

Pubmed 19273683

 

prodomImg

pubmed

136

405

S=739 I=56 E=9.99421e-81

Putative replication protein A ; Plasmid

Pubmed 18227089

 

prodomImg

pubmed

133

405

S=714 I=47 E=1.05046e-77

Replication protein

Pubmed 11544236

 

prodomImg

pubmed

146

402

S=371 I=34 E=3.5626e-36

Replication protein ; Plasmid

Pubmed 10618203

 

prodomImg

pubmed

120

403

S=289 I=29 E=3.53297e-26

RepA protein ; Plasmid

Pubmed 11812851

 

prodomImg

pubmed

158

401

S=257 I=32 E=2.25724e-22

RepA replication protein ; Plasmid

Pubmed 10049392

 

prodomImg

pubmed

129

401

S=250 I=27 E=1.67677e-21

RepA protein

Pubmed 12055285

 

prodomImg

pubmed

137

401

S=249 I=29 E=2.2751e-21

Plasmid replication protein

Pubmed 15033235

 

prodomImg

Iprscan IPR006881 [PF04796]

206

363

Plasmid encoded RepA protein

Iprscan [seg]

46

60

-

Iprscan [seg]

406

425

-

PDA098C8

132

205

S=271 I=64 E=2.62591e-25

PDA1L386

276

317

S=155 I=62 E=2.48468e-11

PDA1G5X4

318

368

S=153 I=51 E=5.21342e-11

PD017750

206

276

S=137 I=43 E=4.14905e-09

PDA8K383

274

405

S=118 I=24 E=8.92145e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fNaA52E6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plb00100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
StbB XFF4834R_plc00140
XFF4834R_plc00130
XFF4834R_plc00130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc00150
XFF4834R_plc00150
ID StbB
AC XFF4834R_plc00140
LT XFF4834R_plc00140
OR XFF4834R_plc from 7504 to 8205 on strand -
DE probable plasmid stability protein
IP
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro


Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100506)
MW 25564.9 Da
SQ 233 aa
 
........10........20........30........40........50
| | | | |
MKIAVINFSGNTGKSTVSKHLLYPRLKDAEYIAVESINADEGEGEGDSVR
GKQFGALQEQLLVIDSAVIDVGSSNVEDFVKLMRQYRGSHEDMDLFVIPA
VKEAKQIKDTIATIQALAAMGVPAKKIRVVFNKLEADDTVEDAFYPLIAF
HQDTKSFTLRPAAAIQYSELFQRLRALNVTIGELVSDTTDYKALLREAKT
PEDKQAIAAKISAKRLAASAQENLDSVFAVLTK
XFF4834R

XFF4834R_chr42470 lcl|XFF4834R_chr_4928676_4929383_r2_XFF4834R-XFF4834R_chr42470

1

233

S=585 I=50 E=1.49971e-64

XFF4834R

XFF4834R_chr42470 lcl|XFF4834R_chr_4928676_4929383_r2_XFF4834R-XFF4834R_chr42470

1

233

S=585 I=50 E=1.49971e-64

XFF4834R

lcl|stbB-XALq_3211

1

233

S=1110 I=92 E=1.12576e-127

putative stable plasmid inheritance protein

XFF4834R

YP_361529.1 lcl|XCVc0013

1

208

S=556 I=52 E=1.90917e-60

putative plasmid stable inheritance protein

XFF4834R

NP_644750.1 lcl|XACb0022-XACb0022

71

233

S=431 I=53 E=2.42779e-45

hypothetical protein

XFF4834R

NP_644701.1 lcl|XACa0015-XACa0015

71

233

S=431 I=53 E=2.42779e-45

hypothetical protein

XFF4834R

NP_644751.1 lcl|XACb0023-XACb0023

1

71

S=186 I=49 E=1.12844e-15

hypothetical protein

XFF4834R

NP_644700.1 lcl|XACa0014-XACa0014

1

71

S=186 I=49 E=1.12844e-15

hypothetical protein

pubmed

1

233

S=902 I=72 E=6.87083e-101

Putative uncharacterized protein ; Plasmid

Pubmed 14645321

 

prodomImg

pubmed

1

233

S=902 I=72 E=6.87083e-101

StbB ; Plasmid

Pubmed 18268088

 

prodomImg

pubmed

1

233

S=897 I=71 E=3.15971e-100

Putative uncharacterized protein ; Plasmid

Pubmed 16391056,7022127

 

prodomImg

pubmed

1

233

S=895 I=71 E=5.10394e-100

Conserved hypothetical plasmid protein

Pubmed 18268088

 

prodomImg

pubmed

1

231

S=571 I=50 E=9.58375e-61

Putative uncharacterized protein ; Plasmid

Pubmed 12534468

 

prodomImg

pubmed

1

231

S=569 I=51 E=1.56164e-60

Putative uncharacterized protein orf16 ; Plasmid

Pubmed 16707697,2175388

 

prodomImg

pubmed

1

231

S=555 I=50 E=9.00129e-59

Putative uncharacterized protein ; Plasmid

Pubmed 15288784

 

prodomImg

pubmed

1

231

S=555 I=50 E=9.00129e-59

Putative uncharacterized protein ; Plasmid

Pubmed 10719200

 

prodomImg

pubmed

1

231

S=419 I=38 E=2.27743e-42

Stability/partitioning determinant ; Plasmid

Pubmed 15262947

 

prodomImg

pubmed

2

231

S=402 I=37 E=2.65997e-40

Stability protein ; Plasmid

Pubmed 14634868

 

prodomImg

PD117512

72

213

S=390 I=55 E=8.01326e-40

PD683571

1

77

S=195 I=47 E=3.61498e-16

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OgfsChzf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plc00140.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plc00140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plc00140.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9Jl2bF/XFF4834R_plc00140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plc00400
XFF4834R_plc00390
XFF4834R_plc00390
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc00410
XFF4834R_plc00410
ID
AC XFF4834R_plc00400
LT XFF4834R_plc00400
OR XFF4834R_plc from 32608 to 34101 on strand +
DE Putative replication protein
IP
CL 8.2.1 replication and maintenance GO:0006261 GO:0006276
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 55522.7 Da
SQ 497 aa
 
........10........20........30........40........50
| | | | |
MGTKTQAQLALFSIDDEAQTYHDAGRTGFFSLLVDQRGEKRQSSHKLTDM
PAVLGLIDKDRDTWMTQAEFMRPNRRVVNLLRIGLLFADIDTYRQPWAVG
RTPEQLAAAVLFHCAEEGLPTPSLIVYSGRGLQAKWLMDGTIPRQALPRW
NACQRYLIDRLAALGADPQAKDASRVLRLVDTVNTKSGNICRVVHVESGQ
DGHPIRYNFEYLAEALLPKARWTIEQQRQDRADRRERQQLRLLPGGKSDN
LRGFSGRQLAWDRLEDLRTLATLRGGVREGERMQHLFWRLNFLLLSGATH
SGQMYHEAAALAGELDARWNYRSKELMTLYSKAKAYEAGEKVTLGDKEFA
PLYTPKNDTLINLFQITSDEQAQLRTIIGAGMAKERDRKRHEAKRRAAGA
VDRETYLDAAQAKRKQAQALKAEGLSVRVIAQRMGVSVGAVAGYLKAPQE
RSRSVRITADQSSMSAGIAGTADGAQCGVQGPSVLLMAEPRGRDLRA
Show or not Domain decomposition
 
XFF4834R

lcl|XALq_3198

1

490

S=2131 I=83 E=0

putative replication protein

pubmed

6

493

S=1915 I=74 E=0

Replication protein ; Plasmid

Pubmed 18591274

 

prodomImg

pubmed

8

483

S=1629 I=69 E=0

Replication protein ; Plasmid

Pubmed 18413319

 

prodomImg