Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr04670XFF4834R_chr04850106_0537152_f3_XFF4834R-XFF4834R_chr04670XFF4834R_chr04670putative phage-related integrase protein
  2. XFF4834R_chr11280XFF4834R_chr11280putative phage-related integrase C-terminal fragment, pseudogene
  3. XFF4834R_chr13420XFF4834R_chr14310424_1541854_f2_XFF4834R-XFF4834R_chr13420XFF4834R_chr13420putative phage-related integrase
  4. XFF4834R_chr36770intAXFF4834R_chr36770putative phage-related integrase protein
  5. XFF4834R_chr42660XFF4834R_chr42660putative cointegrate resolution protein T C-terminal fragment, pseudogene
  6. XFF4834R_pla00170XFF4834R_pla00170resolvase pseudogene, N-terminal fragment

XFF4834R_chr04850106_0537152_f3_XFF4834R-XFF4834R_chr04670 XFF4834R_chr04670
XFF4834R_chr_0518
XFF4834R_chr_0518
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0520
XFF4834R_chr_0520
ID XFF4834R_chr04850106_0537152_f3_XFF4834R-XFF4834R_chr04670
AC XFF4834R_chr04670
LT XFF4834R_chr04670
OR XFF4834R_chr from 536106 to 537152 on strand +
DE putative phage-related integrase protein
IP Integrase, catalytic core, phage; DNA breaking-rejoining enzyme, catalytic core
CL 8.1.4 Integration, recombination GO:0015074 GO:0006310 GO:0019047
EC
GO InterPro
Biological Process: DNA integration (GO:0015074)
Biological Process: DNA recombination (GO:0006310)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20100324)
MW 39604.9 Da
SQ 348 aa
 
........10........20........30........40........50
| | | | |
MGEYPEMSLAAARTEHDKARALVKQALHPAHSRQAERLSNQAANANTFEA
IANEWISKKSGSWTPYYRRQVENFLTADVFPHIGRLPIRAVTAAHLLAII
KRVEQRGAATVALLVRQWSSAIFRYAVATLRADSDPAAALRGAIHRPKVE
HHRPLSREQISQFGTALEKYGGYRTTVIALHLMLLTFVRTVELRNARWQE
FDLDQATWRIPAERMKMREPHIVPLSKQAIELLKELHTHTGGRGLLFPNY
RRPQESMTATTLNRALERMGFNGKGSTGFSAHGFRATASTFLNEMGFRAD
VIERQLAHAERNKVRASYNQAEYLQERVAMMQRWADYLEGLRTQQPTN
XFF4834R

XFF4834R_chr36770 lcl|intA-XFF4834R_chr36770

1

342

S=605 I=40 E=8.01036e-67

CP4-57 prophage; integrase

XFF4834R

XFF4834R_chr_3172 lcl|XFF4834R_chr32640435_3452962_f2_acur-XFF4834R_chr_3172

1

112

S=188 I=39 E=3.01995e-16

XFF4834R

XFF4834R_chr36770 lcl|intA-XFF4834R_chr36770

1

342

S=605 I=40 E=8.01036e-67

CP4-57 prophage; integrase

XFF4834R

XFF4834R_chr_3172 lcl|XFF4834R_chr32640435_3452962_f2_acur-XFF4834R_chr_3172

1

112

S=188 I=39 E=3.01995e-16

XFF4834R

lcl|XALc_1632

1

343

S=656 I=43 E=1.97977e-72

putative phage-related integrase protein

XFF4834R

lcl|XALc_1804

1

341

S=645 I=43 E=5.20659e-71

putative phage-related integrase protein

XFF4834R

YP_363948.1 lcl|XCV2217

1

343

S=643 I=44 E=8.26491e-71

phage-related integrase

pubmed

1

342

S=683 I=43 E=4.82807e-74

Gp28

Pubmed 18952876

 

prodomImg

pubmed

1

345

S=674 I=39 E=6.3211e-73

Integrase

Pubmed 11598060

 

prodomImg

pubmed

1

345

S=673 I=39 E=6.66057e-73

Int

Pubmed 10411725

 

prodomImg

pubmed

1

345

S=673 I=39 E=7.65765e-73

Int

Pubmed 16428402

 

prodomImg

pubmed

1

345

S=671 I=39 E=1.43458e-72

Putative integrase Sai integrase

Pubmed 10411724

 

prodomImg

pubmed

1

338

S=661 I=40 E=1.92798e-71

Integrase

Pubmed 1712012

 

prodomImg

pubmed

1

341

S=659 I=39 E=3.83916e-71

Putative integrase CP4-like integrase

Pubmed 9673266

 

prodomImg

pubmed

1

344

S=646 I=43 E=1.34626e-69

Integrase ; DNA integration recombination

Pubmed 2183201,3119856

 

prodomImg

pubmed

1

338

S=630 I=42 E=1.29795e-67

P4 integrase-like protein

Pubmed 10542186

 

prodomImg

pubmed

1

344

S=604 I=39 E=1.95046e-64

IntB

Pubmed 11325940

 

prodomImg

sp_Pdown

sp|P08320|VINT_BPP4

1

344

S=646 I=43 E=9.26842e-70

Integrase ; DNA integration recombination

sp_Pdown

sp|P76542|INTZ_ECOLI

1

341

S=530 I=37 E=1.14915e-55

Putative prophage CPZ-55 integrase ; DNA integration recombination

sp_Pdown

sp|P32053|INTA_ECOLI

2

340

S=522 I=34 E=1.06154e-54

Prophage CP4-57 integrase ; DNA integration recombination

sp_Pdown

sp|P39347|INTB_ECOLI

1

339

S=516 I=36 E=6.12384e-54

Putative prophage P4 integrase ; DNA integration recombination

sp_Pdown

sp|P37317|VINT_BPSFV

1

339

S=484 I=34 E=3.64896e-50

Integrase ; DNA integration recombination

Iprscan [G3DSA:1.10.150.130]

46

146

-

Iprscan IPR013762 [G3DSA:1.10.443.10]

153

309

Integrase-like, catalytic core, phage

Iprscan IPR002104 [PF00589]

155

322

Integrase, catalytic core, phage

PD155103

269

324

S=170 I=66 E=4.1865e-13

PD344297

213

268

S=160 I=58 E=6.35683e-12

PDA5E5W5

215

344

S=158 I=31 E=9.83028e-12

PDA6R9H2

44

100

S=156 I=49 E=1.76304e-11

PDA1E5N8

96

152

S=146 I=52 E=3.27146e-10

PD897129

1

147

S=116 I=28 E=1.4242e-06

PDA4Z0H3

148

234

S=116 I=31 E=1.51383e-06

PDA5G2N2

191

243

S=114 I=46 E=2.26077e-06

PDA95977

48

271

S=108 I=25 E=1.16445e-05

Iprscan IPR011010 [SSF56349]

152

332

DNA breaking-rejoining enzyme, catalytic core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dzL7Wfp5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

84 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr04670.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr04670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr04670.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr04670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr11280

Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence

ID
AC XFF4834R_chr11280
LO XFF4834R_chr11280
DE putative phage-related integrase C-terminal fragment, pseudogene
CL 8.1.4 Integration, recombination GO:0015074 GO:0006310 GO:0019047
GO InterPro


Curated
PM
AN A complete ortholog (Xfasm12-1638) is present in Xylella. XFF4834R_chr_1209 has been deleted and replaced by this pseudogene.
CC MODEL:
CC STATUS: curated by darrasse (20121001)
SQ 144 nt
 
........10........20........30........40........50
| | | | |
ATGGCGGAAGACAACAAAAAAACCGGCGCATGGCCGGCTTTTTTCTTCGC
GTCGAAACCCATGGAATGCCTGGATTTCAATGGTGGGCGGTACAGGGTTC
GAACCTGTGACCCTTGCCGTGTGAAGGCAATGCTCTACCGCTGA
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2eEXhZZo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr11280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr11280.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr11280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr11280.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr14310424_1541854_f2_XFF4834R-XFF4834R_chr13420 XFF4834R_chr13420
XFF4834R_chr13410
XFF4834R_chr13410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13430
XFF4834R_chr13430
ID XFF4834R_chr14310424_1541854_f2_XFF4834R-XFF4834R_chr13420
AC XFF4834R_chr13420
LT XFF4834R_chr13420
OR XFF4834R_chr from 1540424 to 1541854 on strand +
DE putative phage-related integrase
IP Integrase, catalytic core, phage
CL 8.1.4 Integration, recombination GO:0015074 GO:0006310 GO:0019047
EC
GO InterPro
Biological Process: DNA integration (GO:0015074)
Biological Process: DNA recombination (GO:0006310)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20100408)
MW 51553.6 Da
SQ 476 aa
 
........10........20........30........40........50
| | | | |
MVRPLHLRPGDAARLVSAYMGMALSNAFQALRQGKPVDLDEVLRRIREQG
LRELTLTDVTLPNGTHLGKAQIDTPEDAALFAELLREPASGNAAPAKPSG
WRTGKAKASGPLLSKAIADHLGDLGRAKLHSKTVLESRHSLRLFAGAVGQ
DLAVSELTADHVRAFFDVVRWWPSNATKRAPYKGLAVMEVVALAQANQVP
EPAAWTVAKHRQRLSVFLVSLVSAGLLASNPLAGIRAIATPDADDTGEPF
TDAELKAIFDPVAFPAWAKKYPHRWFGPMLGLYSGARVNEIAQLRVDDID
TIDGVPGFFVRQGGKGQSVKNKNSRRFVPLAKPVVDAGFLVYIDEVRKAG
HTQIFPHLPNSTGLGFGRQLSRQFSVYIKRQGITAKGQGFHGFRHTIASR
LDEAGVSASAIAAITGHARGQGVLEKFYIDRRTLPDRVATLARLIVPAML
PLYIAGQFDVSFEGPSSTLRESAGRQ
XFF4834R

XFF4834R_chr28510 lcl|XFF4834R_chr31020864_3284312_r2_XFF4834R-XFF4834R_chr28510

250

406

S=238 I=35 E=3.70621e-22

XFF4834R

XFF4834R_chr28510 lcl|XFF4834R_chr31020864_3284312_r2_XFF4834R-XFF4834R_chr28510

3

99

S=101 I=29 E=1.4375e-05

XFF4834R

XFF4834R_chr11010 lcl|XFF4834R_chr11470499_1233031_r3_XFF4834R-XFF4834R_chr11010

254

417

S=210 I=31 E=8.31738e-19

XFF4834R

XFF4834R_chr11010 lcl|XFF4834R_chr11470499_1233031_r3_XFF4834R-XFF4834R_chr11010

13

99

S=96 I=30 E=5.55286e-05

XFF4834R

YP_365144.1 lcl|XCV3413

20

389

S=1746 I=91 E=0

putative phage-related integrase

XFF4834R

NP_643606.1 lcl|XAC3298-XAC3298

1

453

S=1570 I=65 E=0

integrase

XFF4834R

YP_363284.1 lcl|XCV1553

1

463

S=705 I=37 E=3.53508e-78

phage-related integrase

XFF4834R

NP_641844.1 lcl|int-XAC1510

1

463

S=698 I=37 E=2.60321e-77

phage-related integrase

XFF4834R

NP_641832.1 lcl|int-XAC1498

112

458

S=538 I=35 E=6.40031e-58

integrase

XFF4834R

NP_636983.1 lcl|XCC1613

112

466

S=509 I=36 E=2.42353e-54

phage-related integrase

XFF4834R

NP_643590.1 lcl|XAC3282-XAC3282

112

299

S=304 I=37 E=1.35845e-29

integrase

XFF4834R

NP_636967.2 lcl|XCC1597

250

417

S=236 I=34 E=2.48427e-21

phage-related integrase

XFF4834R

YP_362857.1 lcl|XCV1126

254

417

S=230 I=34 E=1.29077e-20

putative integrase

XFF4834R

NP_641445.2 lcl|XAC1107-XAC1107

254

417

S=213 I=33 E=1.54753e-18

integrase

pubmed

143

436

S=134 I=22 E=2.51319e-07

Putative uncharacterized protein

Pubmed 18441064

 

prodomImg

pubmed

143

436

S=133 I=21 E=2.69474e-07

Putative uncharacterized protein

Pubmed 15056931

 

prodomImg

pubmed

143

436

S=133 I=22 E=2.74214e-07

Putative uncharacterized protein

Pubmed 15056931,18441064

 

prodomImg

pubmed

143

436

S=133 I=22 E=2.99196e-07

Putative uncharacterized protein

Pubmed 18441064

 

prodomImg

pubmed

250

427

S=120 I=28 E=1.1152e-05

Integrase

Pubmed 10049830

 

prodomImg

Iprscan IPR013762 [G3DSA:1.10.443.10]

250

430

Integrase-like, catalytic core, phage

Iprscan IPR002104 [PF00589]

282

419

Integrase, catalytic core, phage

Iprscan [seg]

214

229

-

PD858450

98

186

S=310 I=63 E=6.03155e-30

PD655348

20

71

S=214 I=79 E=1.97329e-18

PDA0X3H4

187

271

S=194 I=43 E=6.50454e-16

PD689534

340

423

S=171 I=44 E=3.71358e-13

PDA0X3H6

252

407

S=165 I=27 E=1.78387e-12

PDA0T227

270

339

S=159 I=45 E=1.07494e-11

PD622830

424

453

S=122 I=73 E=3.2139e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LkCGmHq8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr13420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr13420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr13420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr13420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
intA XFF4834R_chr36770
XFF4834R_chr36760
XFF4834R_chr36760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36780
XFF4834R_chr36780
ID intA
AC XFF4834R_chr36770
LT XFF4834R_chr36770
OR XFF4834R_chr from 4254249 to 4255439 on strand -
DE putative phage-related integrase protein
IP Integrase, catalytic core, phage; TonB box, conserved site
CL 8.1.4 Integration, recombination GO:0015074 GO:0006310 GO:0019047
EC
GO InterPro
Biological Process: DNA integration (GO:0015074)
Biological Process: DNA recombination (GO:0006310)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: validated by jacques (20110713)
MW 44036.9 Da
SQ 396 aa
 
........10........20........30........40........50
| | | | |
VPLTDTAIRKAKPATTVQKLRDGGGLYLLLRPDGAKWWRWDYRRPVTSKR
NTLSLGTYPDVSLATARERHAAARKLLAEGIDPGEQRKAEKSATFERSAN
TFEVVAAEHLAMRAHKLSAGSVVRERRLLQKDLGPYIGSRPIDAIPARDL
LEALRKIEGRGAMETAHRARMLAAQVFRYAIATGRAERNPASDLKGALTP
PEGRHFASVTEPVLVGELLRAIHGYRGSPVVMGALQLAPLVFVRPGELRR
ARWENIELDSSEWRFTASKTAQSHVVPLSSQAVAILSDLHPLTGRGEFVF
PSVRGRGRPMSENTINAALRRLGYDADTMTGHGFRAMARTVLDEVLGFRP
DYIEHQLAHAVRDPNGRAYNRTAHLVERRKMMQAWADYLDSLRASI
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 077Ycl76)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

76 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr36770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr36770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr36770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr36770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr42660

Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence

ID
AC XFF4834R_chr42660
LO XFF4834R_chr42660
DE putative cointegrate resolution protein T C-terminal fragment, pseudogene
CL 8.1.4 Integration, recombination GO:0015074 GO:0006310 GO:0019047
GO InterPro


Curated
PM
AN XFF4834R_chr_4541 has been deleted. Orthologs are xcv2437 xacb0010
CC MODEL:
CC STATUS: by darrasse (20120930)
SQ 471 nt
 
........10........20........30........40........50
| | | | |
ATGCAGCTCAACCGGGACAACGGCCAGTGGCTGGAACGCCAGACCCGGCT
GGAGCGGGAACTGGCGCAGGCACGCCAGCGGGCCGACGCCCAGCAACGCG
AGCGCGACGCGCTGCGCCTGACGGCCGCCGAGTACCAAGCCCTGCAGGTG
CGCTGGACCCAAGATGTCCAAGCGCTGGAAGGCGTGCGCGCCGAACTGGC
TGCGGCGCGGACCGAGCTGGTCGAAGAGCGCCAGCGCCGGGAACACGCCG
AGGCGGACACCTTGCGCGCCACGGTGCGCCTGGGCACACTGGAACAGTTA
CTGGCGCAACTGCGGCCACCGCACCCGTTGGCGAACCCGAAAACGCCGTC
GCAGCCGGTGCAATGCCGACAGGCGGGTGATCAGCCAGTTGGGGAAAGGT
ATGAATCATCCTCAGCGTCAATGCTTCGCCGTCACAGTTATGGCTTCGTT
GCACCAACGAGAAAAGGATAG
Show or not Domain decomposition
 
Iprscan [coil]

7

49

-

Iprscan [coil]

59

87

-

Iprscan [seg]

16

39

-

Iprscan [seg]

67

79

-

Iprscan [seg]

8

45

-

Iprscan [seg]

58

85

-

Iprscan [seg]

90

110

-

Iprscan [seg]

11

29

-

Iprscan [seg]

64

77

-

Iprscan [seg]

47

66

-

Iprscan [seg]

112

149

-

Iprscan [seg]

42

74

-

Iprscan [seg]

80

117

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dafwmjod)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr42660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr42660.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr42660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_chr42660.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00170

Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence

ID
AC XFF4834R_pla00170
LO XFF4834R_pla00170
DE resolvase pseudogene, N-terminal fragment
CL 8.1.4 Integration, recombination GO:0015074 GO:0006310 GO:0019047
GO InterPro
Biological Process: DNA recombination (GO:0006310)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: recombinase activity (GO:0000150)

Curated
PM
AN this fragment contains a Recombinase, conserved site. This fragment includes the primer X4e (position 11774 to 11796 on plasmid 1) described by Audy et al 1994, and that allows with the primer X4c (position 12586 to 12563 on plamid 1) the specific dectection of phaseoli by PCR.
CC MODEL:
CC STATUS: curated by darrasse (20120314)
SQ 270 nt
 
........10........20........30........40........50
| | | | |
ATGTTAGTGGGCTACATGCGCGTGTCGTCCGATTCCGACCGCCAGAGCAC
AGACTTGCAGCGTGACGCCCTGCTCGCTGCCGGCGTCGATGCCCGGCACC
TCTTCGAGGATCGTGCTTCCGGCGCGAAGGATGACCGGGCTGGCTTGGCG
CGGGCGCTCGAATTCGTGTGCCCTGGCGACGTGCTGGTGGTGTGGAAGCT
GGATAGGCTCGGCCGCTCACTATCGCACCTGCTCACCATCGTGACCGAGC
GTGTGCAGAATTTTGTGTAA
Show or not Domain decomposition
 
Iprscan IPR006119 [G3DSA:3.40.50.1390]

1

83

Resolvase, N-terminal

Iprscan IPR006119 [PF00239]

3

83

Resolvase, N-terminal

Iprscan IPR006119 [SM00857]

2

89

Resolvase, N-terminal

Iprscan IPR006118 [PS00398]

59

71

Recombinase, conserved site

Iprscan [seg]

43

59

-

Iprscan [seg]

57

70

-

Iprscan [SignalP-NN(euk)]

1

14

-

Iprscan IPR006119 [SSF53041]

1

83

Resolvase, N-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3Z6jdJIv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_pla00170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_pla00170.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_pla00170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZJWi83/XFF4834R_pla00170.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.