Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18610XFF4834R_chr18610Putative Maf-like protein

XFF4834R_chr18610
XFF4834R_chr18600
XFF4834R_chr18600
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18620
XFF4834R_chr18620
ID
AC XFF4834R_chr18610
LT XFF4834R_chr18610
OR XFF4834R_chr from 2128362 to 2128934 on strand +
DE Putative Maf-like protein
IP Maf-like protein
CL 7.1 Cytoplasm GO:0005737
EC
GO InterPro
Cellular Component: cytoplasm (GO:0005737)

Curated
PM
AN
CC COG: [D] Cell cycle control, cell division, chromosome partitioning;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 20523.3 Da
SQ 190 aa
 
........10........20........30........40........50
| | | | |
MLYLASRSPRRQELLQRLDVPFQTLQLDVPELRAADESPDQYVQRVALEK
AHAGLALVQAADPDAIVLGSDTEVVLGERVFGKPLDVDDAIAMLRELSGR
THQVLTAVVLVCAQRAPAQALVVSQVTFDTLDEAQIAAYVACGEPMGKAG
AYAIQGRAERFIRHLSGSYSGVMGLPLYHTSQLLTAFGAH
Hamap MAF_MF_00528 raw_score=3160 norm_score=29.260

Septum formation protein Maf [maf].

XFF4834R

XFF4834R_chr11140 lcl|XFF4834R_chr11620393_1246965_r1_XFF4834R-XFF4834R_chr11140

2

188

S=155 I=33 E=1.31816e-12

predicted protein

XFF4834R

YP_364659.1 lcl|maf-XCV2928

1

190

S=950 I=97 E=2.37413e-108

Maf-like protein

XFF4834R

NP_643080.1 lcl|maf-XAC2771

1

190

S=949 I=97 E=3.48426e-108

Maf-like protein

XFF4834R

NP_637958.1 lcl|maf-XCC2610

1

190

S=803 I=84 E=1.4228e-90

Maf-like protein

XFF4834R

lcl|XALc_2461

1

188

S=500 I=63 E=6.86761e-54

putative nucleotide-binding protein implicated in inhibition of septum formation, maf-like protein

XFF4834R

NP_636389.1 lcl|maf-XCC1013

2

188

S=181 I=34 E=3.70651e-15

Maf-like protein

XFF4834R

NP_641457.1 lcl|maf-XAC1120

2

188

S=166 I=34 E=2.31083e-13

Maf-like protein

XFF4834R

lcl|XALc_0621

2

188

S=110 I=35 E=1.5654e-06

putative maf-like protein

pubmed

2

189

S=418 I=53 E=2.52884e-42

Maf-like protein yhdE ; Cytoplasm

Pubmed 1937035

 

prodomImg

pubmed

2

187

S=349 I=43 E=5.27075e-34

Septum formation protein Maf ; Cytoplasm Disulfide bond

Pubmed 8387996,1400224

 

prodomImg

pubmed

2

187

S=287 I=38 E=1.67086e-26

Maf-like protein Wbm0192 ; Cytoplasm

Pubmed 15780005

 

prodomImg

pubmed

2

187

S=285 I=39 E=3.38568e-26

Maf-like protein WP0036 ; Cytoplasm

Pubmed 18550617

 

prodomImg

pubmed

2

187

S=270 I=39 E=2.00323e-24

Maf-like protein AM793 ; Cytoplasm

Pubmed 15618402

 

prodomImg

pubmed

1

177

S=269 I=38 E=2.55713e-24

Maf-like protein TON_1078 ; Cytoplasm

Pubmed 18790866

 

prodomImg

pubmed

2

187

S=264 I=37 E=1.13565e-23

Maf-like protein Erum5100/ERWE_CDS_05350 ; Cytoplasm

Pubmed 15637156

 

prodomImg

pubmed

2

188

S=263 I=37 E=1.30566e-23

Maf protein ; Cytoplasm

Pubmed 12446909

 

prodomImg

pubmed

2

187

S=260 I=35 E=3.62118e-23

Maf-like protein Ecaj_0518 ; Cytoplasm

Pubmed 16707693

 

prodomImg

pubmed

2

188

S=255 I=32 E=1.49986e-22

Maf-like protein THA_448 ; Cytoplasm

Pubmed 19124572

 

prodomImg

sp_Pdown

sp|Q3BRF4|Y2928_XANC5

1

190

S=950 I=97 E=5.70148e-107

Maf-like protein XCV2928 ; Cytoplasm

sp_Pdown

sp|Q8PIX4|Y2771_XANAC

1

190

S=949 I=97 E=8.36746e-107

Maf-like protein XAC2771 ; Cytoplasm

sp_Pdown

sp|Q5GXK1|Y3316_XANOR

1

190

S=933 I=95 E=6.43092e-105

Maf-like protein XOO3316 ; Cytoplasm

Iprscan [G3DSA:3.90.950.10]

2

188

-

Iprscan IPR003697 [MF_00528]

1

190

Maf-like protein

Iprscan IPR003697 [PIRSF006305]

1

190

Maf-like protein

Iprscan IPR003697 [PF02545]

1

190

Maf-like protein

Iprscan IPR003697 [TIGR00172]

1

185

Maf-like protein

PD005766

6

190

S=379 I=48 E=2.01734e-38

PDA398X1

62

176

S=147 I=32 E=2.47214e-10

PD890595

2

51

S=113 I=50 E=3.46175e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DwJJfPL7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

456 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_KTQai/XFF4834R_chr18610.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_KTQai/XFF4834R_chr18610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_KTQai/XFF4834R_chr18610.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_KTQai/XFF4834R_chr18610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.