Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr15370rimJXFF4834R_chr15370probable ribosomal protein S5 alanine N-acetyltransferase
  2. XFF4834R_chr18550XFF4834R_chr19890270_2120683_f2_XFF4834R-XFF4834R_chr18550XFF4834R_chr18550hypothetical Iojap-like ribosome associated protein
  3. XFF4834R_chr21240engAXFF4834R_chr21240probable GTP-binding protein EngA

rimJ XFF4834R_chr15370
XFF4834R_chr15360
XFF4834R_chr15360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15380
XFF4834R_chr15380
ID rimJ
AC XFF4834R_chr15370
LT XFF4834R_chr15370
OR XFF4834R_chr from 1770246 to 1770869 on strand +
DE probable ribosomal protein S5 alanine N-acetyltransferase
IP Acyl-CoA N-acyltransferase
CL 6.6 Ribosome GO:0009281
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: N-acetyltransferase activity (GO:0008080)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100810)
MW 22956.1 Da
SQ 207 aa
 
........10........20........30........40........50
| | | | |
MSLPRFAPIRRADGVVLCDLAVVDAAAMADYHSRNRVHLADAMPLRPPAF
YTVEGWRRLCMAYRSAMPGEREVQLVLLQGEQVIGTTGFTQIQRGAFQAC
HMGYGLDAAQQGRGLIQWAATQGIAFAFGPLGLHRVMAQYVPENLRSARV
LQRLGFQIEGYARRYLQLNGHWRDHVLTSRLRDDGTLGEGTVDGQPLSGH
SARELDP
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr41460 lcl|XFF4834R_chr_4822327_4822881_r1_XFF4834R-XFF4834R_chr41460

84

160

S=100 I=34 E=7.59582e-06

XFF4834R

NP_643404.1 lcl|rimJ-XAC3095

1

207

S=942 I=87 E=2.33668e-107

ribosomal protein alanine acetyltransferase

XFF4834R

YP_364957.1 lcl|rimJ-XCV3226

1

207

S=884 I=83 E=2.38463e-100

ribosomal protein alanine N-acetyltransferase

XFF4834R

NP_638266.1 lcl|rimJ-XCC2918

1

185

S=712 I=75 E=1.74206e-79

ribosomal protein alanine acetyltransferase

XFF4834R

lcl|XALc_0875

79

184

S=220 I=42 E=8.39374e-20

hypothetical acetyltransferase protein

XFF4834R

NP_644579.1 lcl|XAC4280-XAC4280

84

160

S=99 I=34 E=3.58931e-05

acetyltransferase

pubmed

31

188

S=266 I=38 E=8.03646e-24

Ribosomal-protein-alanine acetyltransferase EC=2.3.1.128 ; Acyltransferase Cytoplasm

Pubmed 2828880,1356970

 

prodomImg

pubmed

56

184

S=190 I=38 E=1.36951e-14

Probable acetyltransferase PacT

Pubmed 8825087

 

prodomImg

pubmed

51

179

S=179 I=33 E=2.54123e-13

Probable acetylation of 30S S5 subunit

Pubmed 15451099

 

prodomImg

pubmed

75

184

S=162 I=36 E=3.02029e-11

Putative uncharacterized protein

Pubmed 15466567

 

prodomImg

pubmed

75

182

S=151 I=33 E=7.27985e-10

Uncharacterized N-acetyltransferase p20 EC=2.3.1.- ; Acyltransferase

Pubmed 2838827

 

prodomImg

sp_Pdown

sp|Q9I2H6|RIMJ_PSEAE

31

177

S=312 I=46 E=1.36778e-29

Ribosomal-protein-alanine acetyltransferase EC=2.3.1.128 ; Acyltransferase Cytoplasm

sp_Pdown

sp|P0A950|RIMJ_SHIFL

31

188

S=266 I=38 E=5.49597e-24

Ribosomal-protein-alanine acetyltransferase EC=2.3.1.128 ; Acyltransferase Cytoplasm

sp_Pdown

sp|P0A948|RIMJ_ECOLI

31

188

S=266 I=38 E=5.49597e-24

Ribosomal-protein-alanine acetyltransferase EC=2.3.1.128 ; Acyltransferase Cytoplasm

sp_Pdown

sp|P0A949|RIMJ_ECO57

31

188

S=266 I=38 E=5.49597e-24

Ribosomal-protein-alanine acetyltransferase EC=2.3.1.128 ; Acyltransferase Cytoplasm

sp_Pdown

sp|O31633|YJCK_BACSU

33

184

S=262 I=36 E=1.70722e-23

Putative ribosomal-protein-alanine acetyltransferase EC=2.3.1.128 ; Acyltransferase Cytoplasm

Iprscan IPR016181 [G3DSA:3.40.630.30]

5

184

Acyl-CoA N-acyltransferase

Iprscan IPR000182 [PF00583]

80

157

GCN5-related N-acetyltransferase

Iprscan IPR000182 [PS51186]

29

183

GCN5-related N-acetyltransferase

Iprscan [seg]

12

30

-

PDA1V3X5

101

141

S=204 I=98 E=2.88369e-17

PDA5Z0N4

184

207

S=113 I=92 E=3.03714e-06

PDA6P8Z6

142

188

S=106 I=43 E=2.06774e-05

Iprscan IPR016181 [SSF55729]

1

184

Acyl-CoA N-acyltransferase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one e5hYOb9X)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr15370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr15370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr15370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr15370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr19890270_2120683_f2_XFF4834R-XFF4834R_chr18550 XFF4834R_chr18550
XFF4834R_chr18540
XFF4834R_chr18540
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18560
XFF4834R_chr18560
ID XFF4834R_chr19890270_2120683_f2_XFF4834R-XFF4834R_chr18550
AC XFF4834R_chr18550
LT XFF4834R_chr18550
OR XFF4834R_chr from 2120270 to 2120683 on strand +
DE hypothetical Iojap-like ribosome associated protein
IP Iojap-related protein
CL 6.6 Ribosome GO:0009281
EC
GO InterPro


Curated
PM
AN Iojap-like protein = widely distibuted family probably associated with ribosomes but with unknown functions so hypothetical Iojap-like protein
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20100929)
MW 15216.2 Da
SQ 137 aa
 
........10........20........30........40........50
| | | | |
MTSQAQVIKTSLPNPPPSVPALLATVREAVEELKARDVVEIDVRGKSSVC
DYMVVVSGTSTRHVKSIADEVVKFAKRLDVMPLGVEGEREAEWVLVDLGD
VVVHVMLPRVREFYALERLWTVGDQRPSDEDESDELS
Show or not Domain decomposition
 
XFF4834R

YP_364664.1 lcl|XCV2933

1

136

S=621 I=90 E=1.088e-68

hypothetical protein

XFF4834R

NP_643086.1 lcl|XAC2777-XAC2777

1

136

S=621 I=90 E=1.088e-68

hypothetical protein

XFF4834R

NP_637963.1 lcl|XCC2615

1

133

S=576 I=85 E=3.19406e-63

hypothetical protein

XFF4834R

lcl|XALc_2476

1

132

S=460 I=76 E=3.18458e-49

hypothetical iojap-related protein

pubmed

20

121

S=223 I=41 E=5.46855e-19

Uncharacterized protein ybeB

Pubmed 3533535

 

prodomImg

pubmed

37

120

S=115 I=31 E=6.05873e-06

YqeL protein

Pubmed 15558816

 

prodomImg

sp_Pdown

sp|P0AAT8|YBEB_SHIFL

20

121

S=223 I=41 E=3.85333e-19

Uncharacterized protein ybeB

sp_Pdown

sp|P0AAT6|YBEB_ECOLI

20

121

S=223 I=41 E=3.85333e-19

Uncharacterized protein ybeB

sp_Pdown

sp|P0AAT7|YBEB_ECOL6

20

121

S=223 I=41 E=3.85333e-19

Uncharacterized protein ybeB

sp_Pdown

sp|P44471|Y034_HAEIN

21

120

S=188 I=37 E=5.44309e-15

Uncharacterized protein HI0034

sp_Pdown

sp|Q96EH3|CG030_HUMAN

34

122

S=155 I=39 E=6.57201e-11

Uncharacterized protein C7orf30

Iprscan IPR004394 [PF02410]

22

120

Iojap-related protein

Iprscan IPR004394 [TIGR00090]

17

120

Iojap-related protein

Iprscan [seg]

94

105

-

PD226637

1

52

S=244 I=88 E=4.45938e-22

PD008103

53

121

S=112 I=44 E=3.72845e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WBiSum5J)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr18550.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr18550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr18550.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr18550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
engA XFF4834R_chr21240
XFF4834R_chr21230
XFF4834R_chr21230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21250
XFF4834R_chr21250
ID engA
AC XFF4834R_chr21240
LT XFF4834R_chr21240
OR XFF4834R_chr from 2463697 to 2465094 on strand +
DE probable GTP-binding protein EngA
IP GTP-binding protein, HSR1-related; ATPase, AAA+ type, core; Small GTP-binding protein
CL 6.6 Ribosome GO:0009281
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
Molecular Function: GTP binding (GO:0005525)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Curated
PM
AN engA (der) is annotated 50S ribosome-associated factor, involved in ribosome biogenesis in GenProtEC Hwang and Inouye 2006: A unique GTP-binding protein, Der contains two consecutive GTP-binding domains at the N-terminal region and its homologues are highly conserved in eubacteria but not in archaea and eukaryotes. In the present paper, we demonstrate that Der is one of the essential GTPases in Escherichia coli and that the growth rate correlates with the amount of Der in the cell. Interestingly, both GTP-binding domains are required at low temperature for cell growth, while at high temperature either one of the two domains is dispensable. Result of the sucrose density gradient experiment suggests that Der interacts specifically with 50S ribosomal subunits only in the presence of a GTP analogue, GMPPNP. The depletion of Der accumulates 50S and 30S ribosomal subunits with a concomitant reduction of polysomes and 70S ribosomes. Notably, Der-depleted cells accumulate precursors of both 23S and 16S rRNAs. Moreover, at lower Mg2+ concentration, 50S ribosomal subunits from Der-depleted cells are further dissociated into aberrant 50S ribosomal subunits; however, 30S subunits are stable. It was revealed that the aberrant 50S subunits, 40S subunits, contain less ribosomal proteins with significantly reduced amounts of L9 and L18. These results suggest that Der is a novel 50S ribosome-associated factor involved in the biogenesis and stability of 50S ribosomal subunits. We propose that Der plays a pivotal role in ribosome biogenesis possibly through interaction with rRNA or rRNA/r-protein complex. Bharat et al 2006: To probe the cellular phenotype and biochemical function associated with the G domains of Escherichia coli EngA (YfgK, Der), mutations were created in the phosphate binding loop of each. Neither an S16A nor an S217A variant of G domain 1 or 2, respectively, was able to support growth of an engA conditional null. Polysome profiles of EngA-depleted cells were significantly altered, and His(6)-EngA was found to cofractionate with the 50S ribosomal subunit. The variants were unable to complement the abnormal polysome profile and were furthermore significantly impacted with respect to in vitro GTPase activity. Together, these observations suggest that the G domains have a cooperative function in ribosome stability and/or biogenesis.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120307)
MW 51324.8 Da
SQ 465 aa
 
........10........20........30........40........50
| | | | |
MLPLVALVGRPNVGKSTIFNALTRTRDALVHDQPGVTRDRNYGVCRLDEQ
QPFIVVDTGGIAGDEEGLAGATARQARAAAGEADLVLFVVDGREGESSLD
DEILAWLRKLARPTVLVINKIDGTDEETVRSEFARYGFSDVVALSAAHRQ
GIDELLDEVGARLPEEGAGELLDNDPARVRIAFVGRPNVGKSTLVNRLLG
EERMIASEVPGTTRDSIAVDLERDGRQYRLIDTAGLRRRGKVEEAVEKFS
AFKTLQAIEQCQVAVLMLDATEGVTDQDATILGAILDAGRALVVAINKWD
GQSDYQRAQAEDLLSRKLGFVNWAEAVRISALHGSGMRELFHAIHRAHAS
ATHEFSTSEVNQALEIAYETNPPPSIRGHVSKLRYVHPGGANPPTFIVHG
TRLKVLPESYKRYLENFFRKRFKLVGTPVRFIFREGANPYEGKKNPLSDR
QVARKRRLMRHVKGK
Hamap ENGA_MF_00195 raw_score=9509 norm_score=39.761

GTP-binding protein engA [engA].

XFF4834R

XFF4834R_chr42940 lcl|mnmE-XFF4834R_chr42940

183

288

S=161 I=38 E=7.84264e-13

GTPase

XFF4834R

XFF4834R_chr42940 lcl|mnmE-XFF4834R_chr42940

7

100

S=112 I=32 E=7.66855e-07

GTPase

XFF4834R

XFF4834R_chr31750 lcl|era-XFF4834R_chr31750

5

61

S=126 I=46 E=1.52958e-08

membrane-associated, 16S rRNA-binding GTPase

XFF4834R

XFF4834R_chr31750 lcl|era-XFF4834R_chr31750

181

289

S=122 I=37 E=4.16889e-08

membrane-associated, 16S rRNA-binding GTPase

XFF4834R

XFF4834R_chr27750 lcl|hflX-XFF4834R_chr27750

2

163

S=119 I=35 E=8.59608e-08

predicted GTPase

XFF4834R

XFF4834R_chr20000 lcl|feoB-XFF4834R_chr20000

2

123

S=103 I=30 E=9.69585e-06

fused ferrous iron transporter, protein B: GTP-binding protein/membrane protein

XFF4834R

NP_642347.1 lcl|engA-XAC2021

1

465

S=2335 I=96 E=0

GTP-binding protein EngA

XFF4834R

YP_363803.1 lcl|engA-XCV2072

1

465

S=2331 I=96 E=0

GTP-binding protein EngA

XFF4834R

NP_637352.1 lcl|engA-XCC1987

1

465

S=2319 I=95 E=0

GTP-binding protein EngA

XFF4834R

lcl|engA-XALc_1586

1

465

S=2065 I=83 E=0

probable gtp-binding protein enga.

XFF4834R

NP_639572.1 lcl|trmE-XCC4238

183

288

S=164 I=38 E=1.23583e-12

tRNA modification GTPase TrmE

XFF4834R

NP_639572.1 lcl|trmE-XCC4238

7

100

S=114 I=32 E=1.52913e-06

tRNA modification GTPase TrmE

XFF4834R

YP_366214.1 lcl|trmE-XCV4483

183

288

S=162 I=38 E=2.29509e-12

tRNA modification GTPase TrmE

XFF4834R

YP_366214.1 lcl|trmE-XCV4483

7

100

S=112 I=32 E=2.62547e-06

tRNA modification GTPase TrmE

XFF4834R

NP_644664.2 lcl|trmE-XAC4370

183

279

S=160 I=38 E=3.83887e-12

tRNA modification GTPase TrmE

XFF4834R

NP_644664.2 lcl|trmE-XAC4370

7

100

S=111 I=32 E=3.47037e-06

tRNA modification GTPase TrmE

pubmed

1

463

S=1137 I=47 E=6.23901e-129

Putative GTP-binding protein ; Nucleotide-binding Repeat

Pubmed 15313254

 

prodomImg

pubmed

1

458

S=1001 I=46 E=2.14182e-112

GTP-binding protein engA ; Nucleotide-binding Repeat

Pubmed 10655208

 

prodomImg

pubmed

1

451

S=995 I=45 E=1.0936e-111

GTP-binding protein engA ; Nucleotide-binding Repeat

Pubmed 19077236

 

prodomImg

pubmed

1

444

S=890 I=38 E=5.77453e-99

GTP-binding protein engA ; Nucleotide-binding Repeat

Pubmed 9516544

 

prodomImg

pubmed

3

435

S=847 I=41 E=8.43936e-94

GTP-binding protein engA ; Nucleotide-binding Repeat

Pubmed 18441057

 

prodomImg

pubmed

3

435

S=842 I=40 E=3.20365e-93

GTP-binding protein ; Nucleotide-binding Repeat

Pubmed 12446909

 

prodomImg

pubmed

177

347

S=185 I=32 E=1.6277e-13

GTP-binding protein ; Nucleotide-binding Repeat

Pubmed 12446909

 

prodomImg

pubmed

3

434

S=800 I=39 E=4.18035e-88

GTP-binding protein engA ; Nucleotide-binding Repeat

Pubmed 18263572

 

prodomImg

pubmed

177

344

S=189 I=32 E=4.84452e-14

GTP-binding protein engA ; Nucleotide-binding Repeat

Pubmed 18263572

 

prodomImg

pubmed

3

434

S=731 I=35 E=9.18086e-80

GTP-binding protein engA ; Nucleotide-binding Repeat

Pubmed 18281406

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

5

168

-

Iprscan [G3DSA:3.40.50.300]

178

361

-

Iprscan IPR016484 [MF_00195]

2

437

GTP-binding, EngA

Iprscan IPR016484 [PIRSF006485]

1

441

GTP-binding, EngA

Iprscan IPR002917 [PF01926]

3

122

GTP-binding protein, HSR1-related

Iprscan IPR002917 [PF01926]

179

300

GTP-binding protein, HSR1-related

Iprscan IPR003593 [SM00382]

1

148

ATPase, AAA+ type, core

Iprscan IPR003593 [SM00382]

177

325

ATPase, AAA+ type, core

Iprscan IPR005225 [TIGR00231]

1

161

Small GTP-binding protein

Iprscan IPR016484 [TIGR03594]

3

434

GTP-binding, EngA

Iprscan IPR005225 [TIGR00231]

176

346

Small GTP-binding protein

Iprscan [seg]

69

83

-

PDA1U4V7

37

100

S=229 I=75 E=2.97128e-20

PD005185

367

438

S=181 I=46 E=2.33632e-14

PDA1U839

341

370

S=150 I=97 E=1.16936e-10

PDA1L1C3

436

465

S=136 I=87 E=6.50919e-09

PD759385

226

364

S=135 I=28 E=9.14535e-09

PD202489

224

273

S=129 I=50 E=4.92035e-08

PDA1U840

341

370

S=117 I=77 E=1.10606e-06

PD000414

7

40

S=115 I=65 E=2.09022e-06

PD000414

183

220

S=113 I=61 E=3.71623e-06

PDA9G7Q2

176

247

S=109 I=37 E=1.22703e-05

PDA1N3S9

436

461

S=107 I=77 E=1.89749e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kkHzOmAP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

251 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr21240.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr21240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr21240.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfMhQOj/XFF4834R_chr21240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.