Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr20860XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860XFF4834R_chr20860putative flagellar glycosyl transferase
  2. XFF4834R_chr20910flgMXFF4834R_chr20910probable negative regulator of flagellin synthesis FlgM
  3. XFF4834R_chr20920flgNXFF4834R_chr20920flagella synthesis protein FlgN
  4. XFF4834R_chr32870XFF4834R_chr32870putative Flagellin assembly, membrane protein MviN family protein

XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860 XFF4834R_chr20860
XFF4834R_chr20850
XFF4834R_chr20850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20870
XFF4834R_chr20870
ID XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860
AC XFF4834R_chr20860
LT XFF4834R_chr20860
OR XFF4834R_chr from 2414642 to 2418166 on strand -
DE putative flagellar glycosyl transferase
IP Glycosyl transferase, family 2
CL 6.4 Flagellum GO:0019861
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110228)
MW 128618.7 Da
SQ 1174 aa
 
........10........20........30........40........50
| | | | |
MTPNLVSIVMPTYKPRYFAQALESVLAQTYPALELVICDDDADGAIEAAL
ASRLTGAPFPIRYHRNTPRLGELVSTIKGIGLAQGEYIKFLHDDDVLQHD
CIAQLVEAIERNPGTAMASSRRVRIDDDGQPLPDILATCFPFADDVLIDG
PELVSFLADHTINFIGEPSCVLARRADLLALGNELMALNGKAIHWVGDLA
IYVKLLRHGNLAMLASPLTQFRISSAQFSQGGRDQPGIGDQGHEDLRQGI
RQLGWRRETGDNRQVRVAPLSPHKARVFKPVDLVNALMQSAGMAERVSPT
TWLGVRHPSTVQRALIQERLRAHSGGPRIAVLLVDRHGDAAAVAATGDSL
DAVACYQRHRAWVISSSPQQVAAHGERGVLIGAYGLAATLNRVIAAQDAI
DWVLLVDAGTLFTASGLMMLALEMLALPDDCQAVYADEVMALDNGQLGLA
LRPALYLDMLLSAPATLSRHWAFRHRTLLADGGFPTGPSAAFELDYQLGL
IERYGLACIRHMAEPILIASATPQHDDEDERRAIARHLAERGYVDAVVHS
AGPGRHAVDYRHAQQPLVSILVLVDGRLPQVQRCLESILAKTSYPHYEVL
LLDRGTTEADLHGWLSGIENLGMQQIRVLRFAAEPPREAVCNAAVEYARG
EVLLWLAAGAAVMKADWLEQLLNHALRPEVGAVAGKLLRGDGTVHHAGLL
LGLGAPAARAFEGAAFDESGYLQRLQLDQNYSALSGECLMLPRQLFVDAG
GFDLEPALAQWSDVDLCLRLQQAGYLNVFAARAQLLIDPPDTTPATALDE
EAMYARWLPMMANDPAYNPGFSLDPGAGFALADPRASWRPLQSWRPLPSV
IALPADIEGCGHYRVIQPLRALREAGIAEGVLFNGYLEISELARQDPDVV
ILQRQVGEARLDAMRRMKALSRAFKVYELDDYLPNLPLKNAHREHMPKDI
LKTVRRGLGMVDRFVVSTPALAEAFAGLHSDIRVAENRLPPHWWEHLPAR
GERQGGKPRVGWAGGASHTGDLELIADVVRELADEVEWVFMGMYPFALRQ
HIHHFQPGVPIDRYPAALAAVDLDLALAPVEQNLFNECKSNLRLLEYGAC
GYPVIASDVRCYQGSLPVTLVKNRYRDWIGAIREHLADPDASAAKGAALR
EAVHRDWMLSGSHLDTWRAAWLPG
XFF4834R

XFF4834R_chr15220 lcl|XFF4834R_chr16320014_1748098_r3_XFF4834R-XFF4834R_chr15220

562

775

S=114 I=24 E=9.59465e-07

XFF4834R

XFF4834R_chr15220 lcl|XFF4834R_chr16320014_1748098_r3_XFF4834R-XFF4834R_chr15220

2

126

S=105 I=27 E=1.34692e-05

XFF4834R

XFF4834R_chr28180 lcl|XFF4834R_chr30730560_3250498_r3_XFF4834R-XFF4834R_chr28180

5

132

S=104 I=26 E=1.85969e-05

XFF4834R

NP_642283.1 lcl|rbfC-XAC1957

5

1174

S=5483 I=90 E=0

O-antigen biosynthesis protein

XFF4834R

YP_363731.1 lcl|XCV2000

10

1173

S=4966 I=83 E=0

putative glycosyltransferase

XFF4834R

lcl|XALc_1398

1

1173

S=2525 I=49 E=0

putative glycosyltransferase protein

XFF4834R

NP_637293.1 lcl|rbfC-XCC1928

6

1173

S=2319 I=44 E=0

O-antigen biosynthesis protein

XFF4834R

NP_643905.1 lcl|rfbC-XAC3598

385

821

S=230 I=27 E=4.01234e-20

truncated O-antigen biosynthesis protein

XFF4834R

NP_643905.1 lcl|rfbC-XAC3598

5

130

S=119 I=29 E=9.82834e-07

truncated O-antigen biosynthesis protein

XFF4834R

YP_363457.1 lcl|XCV1726

5

116

S=139 I=31 E=3.80607e-09

glycosyltransferase

XFF4834R

YP_364973.1 lcl|XCV3242

562

813

S=122 I=23 E=3.90041e-07

glycosyltransferase

XFF4834R

NP_643419.2 lcl|XAC3110-XAC3110

562

796

S=122 I=24 E=4.64345e-07

glycosyltransferase

XFF4834R

NP_638281.2 lcl|XCC2933

562

796

S=122 I=23 E=4.93567e-07

glycosyl transferase

pubmed

1

1173

S=3399 I=58 E=0

Putative uncharacterized protein

Pubmed 15028697

 

prodomImg

pubmed

5

848

S=2327 I=56 E=0

Flagellar glycosyl transferase ; Flagellum

Pubmed 11481492,15090491

 

prodomImg

pubmed

5

1173

S=1602 I=35 E=0

Putative glycosyltransferase

Pubmed 14594840

 

prodomImg

pubmed

457

1170

S=882 I=34 E=1.3037e-97

O-antigen biosynthesis protein RbfC

Pubmed 10388713

 

prodomImg

pubmed

302

832

S=782 I=36 E=1.70606e-85

Putative glycosyltransferase

Pubmed 14594840

 

prodomImg

pubmed

434

824

S=370 I=27 E=1.69437e-35

Putative glycosyl transferase

Pubmed 9712783

 

prodomImg

pubmed

5

243

S=346 I=36 E=1.37102e-32

Putative uncharacterized protein

Pubmed 15073305

 

prodomImg

pubmed

469

823

S=279 I=31 E=1.73846e-24

O-antigen biosynthesis protein rfbC ; Lipopolysaccharide

Pubmed 8626291

 

prodomImg

pubmed

566

785

S=267 I=29 E=4.33895e-23

WsaE

Pubmed 11741945,15316277

 

prodomImg

pubmed

558

786

S=266 I=31 E=5.73525e-23

Putative O-antigen biosynthesis protein

Pubmed 15473911

 

prodomImg

Iprscan [G3DSA:3.90.550.10]

5

231

-

Iprscan [G3DSA:3.90.550.10]

566

775

-

Iprscan IPR001173 [PF00535]

7

182

Glycosyl transferase, family 2

Iprscan IPR001173 [PF00535]

569

750

Glycosyl transferase, family 2

Iprscan [seg]

417

427

-

Iprscan [seg]

697

716

-

Iprscan [seg]

1065

1080

-

Iprscan [seg]

1137

1148

-

PDA1I0A3

316

566

S=590 I=52 E=9.2866e-64

PD910181

954

1114

S=426 I=55 E=7.03086e-44

PD322018

833

937

S=347 I=59 E=2.53599e-34

PDA8G3Y6

5

98

S=326 I=67 E=1.03953e-31

PDA132U9

142

227

S=303 I=65 E=5.43934e-29

PDA1K636

229

327

S=233 I=53 E=2.06903e-20

PD813194

100

141

S=207 I=93 E=2.47853e-17

PDA2E9M9

328

380

S=198 I=87 E=3.41927e-16

PD542618

568

631

S=182 I=50 E=3.07446e-14

PD882805

1115

1173

S=174 I=63 E=2.53573e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one cY0lPRu8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

82 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
flgM XFF4834R_chr20910
XFF4834R_chr20900
XFF4834R_chr20900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20920
XFF4834R_chr20920
ID flgM
AC XFF4834R_chr20910
LT XFF4834R_chr20910
OR XFF4834R_chr from 2421043 to 2421354 on strand +
DE probable negative regulator of flagellin synthesis FlgM
IP Anti-sigma-28 factor, FlgM
CL 6.4 Flagellum GO:0019861
EC
GO InterPro
Biological Process: negative regulation of transcription (GO:0016481)
Cellular Component: flagellum (GO:0019861)
Molecular Function: transcription repressor activity (GO:0016564)

Curated
PM
AN
CC COG: [KNU] Transcription;Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110228)
MW 10729.8 Da
SQ 103 aa
 
........10........20........30........40........50
| | | | |
MTQKIEGNLPTAATLRTTATSSKIASAGEDRASPVAATPPTDSVKLTGEA
TNLQNLQRELSQSSAIDTGRVQAVKDALQNGSYSINPDAIASRMMDLNQQ
LAG
Show or not Domain decomposition
 
XFF4834R

YP_363767.1 lcl|XCV2036

1

103

S=462 I=90 E=1.08987e-49

negative regulator of flagellin synthesis

XFF4834R

NP_642315.1 lcl|flgM-XAC1989

1

103

S=462 I=90 E=1.08987e-49

flagellar protein

XFF4834R

NP_637320.1 lcl|flgM-XCC1955

1

103

S=447 I=86 E=5.91008e-48

flagellar protein

XFF4834R

lcl|flgM-XALc_1431

1

101

S=261 I=52 E=1.96664e-25

probable negative regulator of flagellin synthesis protein

Iprscan IPR007412 [PF04316]

42

96

Anti-sigma-28 factor, FlgM

Iprscan IPR007412 [TIGR03824]

3

99

Anti-sigma-28 factor, FlgM

Iprscan [seg]

11

20

-

Iprscan [SSF101498]

2

99

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Cv2tNhF7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
flgN XFF4834R_chr20920
XFF4834R_chr20910
XFF4834R_chr20910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20930
XFF4834R_chr20930
ID flgN
AC XFF4834R_chr20920
LT XFF4834R_chr20920
OR XFF4834R_chr from 2421370 to 2421702 on strand +
DE flagella synthesis protein FlgN
IP FlgN
CL 6.4 Flagellum GO:0019861
EC
GO InterPro
Biological Process: flagellum assembly (GO:0009296)
Cellular Component: flagellum (GO:0019861)

Curated
PM
AN conserve chez les xantho
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110228)
MW 12121.5 Da
SQ 110 aa
 
........10........20........30........40........50
| | | | |
MNVNEFLQRLSDALAGERQALLENDIDGLMRHTQDKLSALQALEAAMPAG
EEERLRELAEANRANGALLARRRREVNWALRHLGRTESAPSYDAKGQSSV
LRGGRSLAVA
XFF4834R

YP_363768.1 lcl|XCV2037

1

110

S=407 I=77 E=5.31289e-43

hypothetical protein

XFF4834R

NP_642316.1 lcl|XAC1990-XAC1990

1

110

S=407 I=77 E=5.31289e-43

hypothetical protein

XFF4834R

NP_637321.1 lcl|XCC1956

1

110

S=346 I=65 E=1.40243e-35

hypothetical protein

XFF4834R

lcl|XALc_1432

2

110

S=228 I=50 E=2.88317e-21

hypothetical protein

Iprscan IPR007809 [PF05130]

5

98

FlgN

Iprscan [seg]

51

75

-

PD598009

1

110

S=370 I=72 E=2.01607e-37

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BYI4cA24)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr20920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr32870
XFF4834R_chr32860
XFF4834R_chr32860
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32880
XFF4834R_chr32880
ID
AC XFF4834R_chr32870
LT XFF4834R_chr32870
OR XFF4834R_chr from 3786509 to 3788116 on strand -
DE putative Flagellin assembly, membrane protein MviN family protein
IP Flagellin assembly, membrane protein MviN
CL 6.4 Flagellum GO:0019861
EC
GO InterPro


Curated
PM
AN IPR004268 Flagellin assembly, membrane protein MviN. This entry represents MviN, a family of integral membrane proteins predicted to have ten or more transmembrane regions. Although frequently listed as a virulence protein, it is not restricted to pathogens and it is an essential protein in Sinorhizobium meliloti. In a number of species its gene is adjacent to that of the uridylyltransferase GlnD, the signal-transducing enzyme that performs the key modification to the nitrogen regulatory protein PII [1]. Disruption of the MviN open reading frame results in flagellar structures that contain only the basal body and hook complex that lack the flagellum; suggesting that MviN might be involved in flagellin export or assembly [2]. Genome comparison studies led to MviN being predicted to be a peptidoglycan lipid II flippase though currently there is no direct evidence to support this annotation [3].
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120307)
MW 58150.6 Da
SQ 535 aa
 
........10........20........30........40........50
| | | | |
MSKPGMLRGLLSFSSMTMISRVLGLIRDQAISTTFGANAVTDAFWVAFRI
PNFLRRLFAEGSFATAFVPVFTEVKETRPHADLRELMARVSGTLGGMLLL
ITALGLIFTPQLAAVFSDGAATDPEKYGLLVDLLRLTFPFLLFVSLTALA
GGALNSFQRFAIPALTPVILNLCMIAGALWLAPRLDVPILALGWAVLVAG
ALQLLFQLPALKGIDLLTLPRWGWNHPDVRKVLTLMIPTLFGSSIAQINL
MLDTVIAARLADGSQSWLSLADRFLELPLGVFGVALGTVILPALARHHVK
TDRTAFSGALDWGFRTTLLIAMPAMLGLLLLAEPLVATLFQYRQFTAFDT
RMTAMSVYGLSFGLPAYAMLKVLLPAFYARQDTRTPVRAGVAALIANMVF
NFALLAVVYQIMVPPELKAQGVMQALGKQPGLHLALGIASALSSYLNLGL
LWYWLGKSGVYQRRPGWGGYALRLLLACAAMVAVLLSLLWWLPSFTQMDK
WNRIGWLAVLVGSGGATYLVAQLALGLRPRHLREG
XFF4834R

NP_641588.1 lcl|mviN-XAC1252

6

535

S=2226 I=85 E=0

virulence factor

XFF4834R

NP_636528.1 lcl|mviN-XCC1153

6

534

S=2170 I=82 E=0

virulence factor

XFF4834R

YP_363019.1 lcl|XCV1288

16

535

S=2160 I=84 E=0

putative Mouse virulence factor family protein

XFF4834R

lcl|mviN-XALc_0920

1

535

S=1718 I=69 E=0

probable virulence factor mvin homolog. transmembrane protein

pubmed

6

409

S=781 I=41 E=1.14986e-85

Virulence factor mviN homolog ; Cell inner membrane Transmembrane

Pubmed 9457888

 

prodomImg

pubmed

5

405

S=745 I=39 E=2.26225e-81

Virulence factor mviN ; Cell inner membrane Transmembrane

Pubmed 8200538

 

prodomImg

pubmed

8

405

S=507 I=34 E=1.72982e-52

Membrane protein

Pubmed 17293531

 

prodomImg

pubmed

17

392

S=403 I=33 E=7.21807e-40

Virulence factor mviN homolog ; Cell inner membrane Transmembrane

Pubmed 11274131

 

prodomImg

pubmed

22

278

S=375 I=35 E=1.6058e-36

MviN

Pubmed 18059491

 

prodomImg

pubmed

5

156

S=364 I=47 E=3.19494e-35

Virulence factor

Pubmed 16550466

 

prodomImg

pubmed

17

182

S=287 I=40 E=7.07225e-26

MviN

Pubmed 11065377

 

prodomImg

pubmed

100

278

S=255 I=33 E=5.01687e-22

MviN

Pubmed 18059491

 

prodomImg

pubmed

209

278

S=124 I=34 E=4.08627e-06

MviN

Pubmed 18059491

 

prodomImg

pubmed

276

395

S=118 I=24 E=2.21773e-05

MviN

Pubmed 12088995

 

prodomImg

sp_Pdown

sp|O34238|MVIN_VIBCH

6

409

S=781 I=41 E=7.91427e-86

Virulence factor mviN homolog ; Cell inner membrane Transmembrane

sp_Pdown

sp|P44958|MVIN_HAEIN

16

407

S=771 I=42 E=1.10138e-84

Virulence factor mviN homolog ; Cell inner membrane Transmembrane

sp_Pdown

sp|P37169|MVIN_SALTY

5

405

S=745 I=39 E=1.55707e-81

Virulence factor mviN ; Cell inner membrane Transmembrane

sp_Pdown

sp|P0AF16|MVIN_ECOLI

5

405

S=741 I=38 E=5.18615e-81

Virulence factor mviN homolog ; Cell inner membrane Transmembrane

sp_Pdown

sp|P0AF17|MVIN_ECO57

5

405

S=741 I=38 E=5.18615e-81

Virulence factor mviN homolog ; Cell inner membrane Transmembrane

Iprscan IPR004268 [PF03023]

31

512

Flagellin assembly, membrane protein MviN

Iprscan IPR004268 [TIGR01695]

5

535

Flagellin assembly, membrane protein MviN

Iprscan [seg]

190

208

-

Iprscan [seg]

318

339

-

Iprscan [seg]

442

456

-

Iprscan [seg]

471

492

-

Iprscan [tmhmm]

94

116

-

Iprscan [tmhmm]

131

153

-

Iprscan [tmhmm]

160

182

-

Iprscan [tmhmm]

187

206

-

Iprscan [tmhmm]

277

299

-

Iprscan [tmhmm]

314

336

-

Iprscan [tmhmm]

357

379

-

Iprscan [tmhmm]

389

411

-

Iprscan [tmhmm]

432

454

-

Iprscan [tmhmm]

469

491

-

Iprscan [tmhmm]

504

526

-

PD600893

221

313

S=258 I=53 E=1.05273e-23

PD005504

6

80

S=173 I=62 E=1.88874e-13

PD872948

73

140

S=145 I=44 E=4.20187e-10

PD918535

412

441

S=131 I=93 E=2.64261e-08

PD539941

360

405

S=129 I=52 E=3.68061e-08

PDA1S5W9

141

175

S=104 I=60 E=4.93825e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one v0AZzchT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr32870.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr32870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr32870.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMSosOF/XFF4834R_chr32870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.