Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr30320XFF4834R_chr32940094_3484573_f2_XFF4834R-XFF4834R_chr30320XFF4834R_chr30320putative peptidoglycan-associated outer membrane lipoprotein
  2. XFF4834R_chr30840bamAXFF4834R_chr30840putative outer membrane antigen

XFF4834R_chr32940094_3484573_f2_XFF4834R-XFF4834R_chr30320 XFF4834R_chr30320
XFF4834R_chr30310
XFF4834R_chr30310
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30330
XFF4834R_chr30330
ID XFF4834R_chr32940094_3484573_f2_XFF4834R-XFF4834R_chr30320
AC XFF4834R_chr30320
LT XFF4834R_chr30320
OR XFF4834R_chr from 3484094 to 3484573 on strand +
DE putative peptidoglycan-associated outer membrane lipoprotein
IP
CL 6.3 Surface antigens (ECA, O antigen of LPS)
EC
GO InterPro


Curated
PM
AN InterPro entry IPR008816: This family consists of several Rickettsia genus specific 17 kDa surface antigen proteins.
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100827)
MW 16329.3 Da
SQ 159 aa
 
........10........20........30........40........50
| | | | |
MKTRLLVIGLAATATLVGCATSQPQYGSYRGDRGYDQGYSQTQRCVDCGI
VTRIDEVGPTRTAPTGTGAVLGGIVGAVAGRQISKETGGSTGNKNVSAVA
GAAAGALAGNAIQNNVTSSSFDVQVRMDDGRVIVVNQRDLAGVRENAYVR
VVNGKVVLR
Show or not Domain decomposition
 
XFF4834R

YP_363254.1 lcl|pcp-XCV1523

1

159

S=581 I=77 E=8.40289e-64

outer membrane lipoprotein

XFF4834R

NP_641800.1 lcl|pcp-XAC1466

1

159

S=576 I=75 E=4.03645e-63

peptidoglycan-associated outer membrane lipoprotein

XFF4834R

NP_636796.1 lcl|pcp-XCC1423

1

159

S=543 I=73 E=3.65508e-59

peptidoglycan-associated outer membrane lipoprotein

XFF4834R

lcl|XALc_1132

1

159

S=321 I=49 E=2.5435e-32

hypothetical protein

Iprscan [PF05433]

65

113

-

Iprscan [PS51257]

1

19

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6nzashxc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30320.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30320.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
bamA XFF4834R_chr30840
XFF4834R_chr30830
XFF4834R_chr30830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30850
XFF4834R_chr30850
ID bamA
AC XFF4834R_chr30840
LT XFF4834R_chr30840
OR XFF4834R_chr from 3547933 to 3550299 on strand +
DE putative outer membrane antigen
IP Outer membrane assembly protein, YaeT
CL 6.3 Surface antigens (ECA, O antigen of LPS)
EC
GO InterPro
Cellular Component: outer membrane (GO:0019867)

Curated
PM
AN start change because of a little overlapping between start of this CDS and the end of the CDS in 5' and also results of Blast
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100625)
MW 87663.4 Da
SQ 788 aa
 
........10........20........30........40........50
| | | | |
MTRLPTRRLLALALAAGLSLPAVALAVEPFVASDIRVDGLQRIASGTVFT
YLPVNRGDTVDDAKVADAIRALYRTGFFEDVQLDRQGNILVITVKERPAI
NKLTVTGNKDIKSEELLKGLGDIGLSEGGTFDRLSLDRVTQELTRQYNNR
GKYNVEITPTVSPLDRNRVDVAIAIKEGKAAKIRHVNLIGTEKFANEDIL
DNWESKEHNWASWYRRDDQYSKEKMSGDLEKLNSWYLDRGYVDFSIDSTQ
VSISPDKRDMFISAGVTEGEQYKISEIKVTGDTVLPQADIERLVIPKAGD
IFSRALLEYTSDAITNTLSNVGYAFAKVNPIPTPNREDRTVAVNLQVVPG
PRVTVRRILYKGNSRTSDEVLRREMRQFENTWYSQAAIDRSKIRLQRLGY
FESVDVETPAVPGSNDQVDVVYNVKETTSGSFVFGLGYSQSFGVTTSVQL
SQNNFLGGGNRVAVEASRSSYQQRYAFSYTNPFFTDDGVSLGYNLSWRAL
DYSDFNTAQFNSKNGSAQVVFGVPITENDTVSAMVGIDSNQITTFAGTTP
QAIIDYINAIGTRTFHAWRTELGWARDTRNDFFMPTRGMYQRVGLETTLP
GSTVEYYKLNYQISNYWPIIPALVLNTRFELGYGDSYGNDSTRVLTNPDG
STRTVTATGLPFYENFYAGGTNSVRGFEDNTLGPRSEAINGYTRGQPLGG
SFKTVGSVEMYFPKLFDSPSARVSAFVDFGNVYSGVDNFKANELRASTGV
ALLWRAPVGPISISYAFPLKKEDNDEIERLQFTFGGQF
XFF4834R

XFF4834R_chr40750 lcl|XFF4834R_chr_4717012_4718793_r1_XFF4834R-XFF4834R_chr40750

638

774

S=124 I=30 E=4.91416e-08

predicted outer membrane protein and surface antigen

XFF4834R

XFF4834R_chr40750 lcl|XFF4834R_chr_4717012_4718793_r1_XFF4834R-XFF4834R_chr40750

256

484

S=104 I=23 E=1.28009e-05

predicted outer membrane protein and surface antigen

XFF4834R

NP_641748.1 lcl|oma-XAC1413

1

788

S=3955 I=96 E=0

outer membrane antigen

XFF4834R

YP_363201.1 lcl|oma-XCV1470

1

788

S=3952 I=96 E=0

outer membrane antigen

XFF4834R

NP_636739.1 lcl|oma-XCC1365

1

788

S=3781 I=91 E=0

outer membrane antigen

XFF4834R

lcl|XALc_2034

1

788

S=3450 I=80 E=0

putative outer membrane antigen precursor protein

XFF4834R

lcl|XALc_3135

637

774

S=138 I=28 E=3.14233e-09

putative outer membrane protein

XFF4834R

lcl|XALc_3135

296

501

S=108 I=23 E=1.53217e-05

putative outer membrane protein

XFF4834R

NP_639424.1 lcl|XCC4085

638

774

S=125 I=29 E=1.10191e-07

hypothetical protein

XFF4834R

YP_366037.1 lcl|XCV4306

638

774

S=124 I=29 E=1.63132e-07

putative outer membrane protein

XFF4834R

YP_366037.1 lcl|XCV4306

256

515

S=104 I=23 E=4.40022e-05

putative outer membrane protein

XFF4834R

NP_644503.1 lcl|XAC4204-XAC4204

638

774

S=120 I=28 E=5.72526e-07

hypothetical protein

XFF4834R

NP_644503.1 lcl|XAC4204-XAC4204

256

484

S=104 I=23 E=4.84313e-05

hypothetical protein

pubmed

27

785

S=1215 I=36 E=4.43931e-138

Outer membrane protein assembly factor yaeT ; Cell Signal

Pubmed 11179681

 

prodomImg

pubmed

27

785

S=1215 I=36 E=4.43931e-138

Outer membrane protein assembly factor yaeT ; Cell Signal

Pubmed 11274153

 

prodomImg

pubmed

28

788

S=1202 I=35 E=1.64032e-136

Predicted outer membrane protein

Pubmed 17526788,17618403

 

prodomImg

pubmed

30

788

S=1129 I=34 E=1.29782e-127

Outer membrane protein omp85 ; Cell Signal

Pubmed 17038831

 

prodomImg

pubmed

30

788

S=1124 I=33 E=4.63495e-127

Outer membrane protein Omp85

Pubmed 9705245

 

prodomImg

sp_Pdown

sp|C5B7R5|YAET_EDWI9

30

785

S=1267 I=37 E=1.78532e-144

Outer membrane protein assembly factor yaeT ; Cell Signal

sp_Pdown

sp|A8GID8|YAET_SERP5

30

785

S=1258 I=37 E=1.92944e-143

Outer membrane protein assembly factor yaeT ; Cell Signal

sp_Pdown

sp|B5Y1J4|YAET_KLEP3

27

785

S=1255 I=37 E=4.11962e-143

Outer membrane protein assembly factor yaeT ; Cell Signal

sp_Pdown

sp|C0Q6K0|YAET_SALPC

27

785

S=1254 I=37 E=5.94142e-143

Outer membrane protein assembly factor yaeT ; Cell Signal

sp_Pdown

sp|Q57T31|YAET_SALCH

27

785

S=1254 I=37 E=6.09887e-143

Outer membrane protein assembly factor yaeT ; Cell Signal

Iprscan IPR016474 [PIRSF006076]

30

788

Outer membrane assembly protein, YaeT

Iprscan IPR000184 [PTHR12815]

455

788

Bacterial surface antigen (D15)

Iprscan IPR000184 [PF01103]

454

788

Bacterial surface antigen (D15)

Iprscan IPR010827 [PF07244]

33

97

Surface antigen variable number

Iprscan IPR010827 [PF07244]

99

178

Surface antigen variable number

Iprscan IPR010827 [PF07244]

182

269

Surface antigen variable number

Iprscan IPR010827 [PF07244]

272

350

Surface antigen variable number

Iprscan IPR010827 [PF07244]

353

426

Surface antigen variable number

Iprscan IPR016474 [TIGR03303]

30

788

Outer membrane assembly protein, YaeT

Iprscan [seg]

9

26

-

Iprscan [seg]

172

183

-

Iprscan [SignalP-NN(euk)]

1

26

-

Iprscan [tmhmm]

9

31

-

PD331895

297

432

S=298 I=49 E=1.89568e-28

PD005071

28

120

S=282 I=55 E=2.11965e-26

PDA1K8T0

528

584

S=248 I=79 E=2.79243e-22

PD332321

435

548

S=223 I=42 E=2.59778e-19

PD454006

218

294

S=202 I=44 E=9.59074e-17

PD003557

584

709

S=189 I=41 E=3.42231e-15

PD590845

297

384

S=139 I=36 E=4.0539e-09

PD590845

120

214

S=138 I=30 E=5.04122e-09

PD590845

218

303

S=129 I=30 E=5.59257e-08

PDA264Z0

119

146

S=135 I=96 E=1.05776e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one arhXqYkf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

36 hits
swiss-prot

Swiss-Prot ncbi-blastp

74 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKM72w8/XFF4834R_chr30840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.