Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr02130XFF4834R_chr02130D-alanine--D-alanine ligase, N-terminal fragment, pseudogene
  2. XFF4834R_chr06680mrdAXFF4834R_chr06680Probable penicillin-binding protein 2 (transpeptidase involved in peptidoglycan synthesis)
  3. XFF4834R_chr37860anmKXFF4834R_chr37860putative Anhydro-N-acetylmuramic acid kinase

XFF4834R_chr02130

Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence

ID
AC XFF4834R_chr02130
LO XFF4834R_chr02130
DE D-alanine--D-alanine ligase, N-terminal fragment, pseudogene
CL 6.2 Peptidoglycan (murein) GO:0009274
GO InterPro
Biological Process: peptidoglycan biosynthetic process (GO:0009252)
Cellular Component: cell wall (GO:0005618)
Molecular Function: D-alanine-D-alanine ligase activity (GO:0008716)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN ORF XFF4834R_chr_0239 has been deleted and replaced by this pseudogene which corresponds to the N-terminal fragment (1/3 of the gene) of a D-alanine--D-alanine ligase gene present in Ecoli and in xanthomonads (XCV0246 XCC0222 XAC0240)
CC MODEL:
CC STATUS: curated by darrasse (20110812)
SQ 330 nt
 
........10........20........30........40........50
| | | | |
ATGATTCGGGTCGGCCTCATCTTCGGCGGCAAATCGGCCGAGCACGAGGT
CTCGTTGCAAGCGGCGCGCAACATCTCTGGATGCGCTGGACCCACAGCGA
TTCGAGGCGGTGCTGATCGGCATCGACTGCTCGCGCTGGACCAGGACACG
CCTTCTGCCATTGCGAATTTCGGGGGGATGGCCGATCGCCTTGCGCGCGT
TGTGTATGTCCATCGCATCGTGATGTCGCGCATGCACGTCGGCGCGATCC
TGCTACGCAGCCGTATGACGAACTCATCCGTCAGTCACGTGCAGCAGGAC
AGCGACGGCTGGTGTGCAAGGTCAATCTGA
Show or not Domain decomposition
 
Iprscan IPR011127 [PF01820]

3

26

D-alanine--D-alanine ligase, N-terminal

Iprscan [seg]

77

87

-

Iprscan [seg]

47

58

-

Iprscan IPR016185 [SSF52440]

1

25

PreATP-grasp-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wHOclryL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr02130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr02130.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr02130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr02130.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
mrdA XFF4834R_chr06680
XFF4834R_chr06670
XFF4834R_chr06670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06690
XFF4834R_chr06690
ID mrdA
AC XFF4834R_chr06680
LT XFF4834R_chr06680
OR XFF4834R_chr from 763761 to 765821 on strand +
DE Probable penicillin-binding protein 2 (transpeptidase involved in peptidoglycan synthesis)
IP Beta-lactamase-type transpeptidase fold; Penicillin-binding protein 2
CL 6.2 Peptidoglycan (murein) GO:0009274
EC
GO InterPro
Biological Process: peptidoglycan-based cell wall biogenesis (GO:0009273)
Molecular Function: penicillin binding (GO:0008658)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100819)
MW 74768 Da
SQ 686 aa
 
........10........20........30........40........50
| | | | |
MHGRRHPKNPHAEAEQFRRRAVLGFVMVVICLVGLGGWYFKLQVLDHEVY
ATRSEANRIKPKPVVPGRGMIYDRTGRLLAENVPAFRLDVTPDKVTDMNA
MLDALGKVIPIAPEDLERFNRERRARRSFLPVTLKLRMSDEEMARFAVER
WRFPGVELEPYLTRRYPYGPLFAHIIGYVGRIDEKDLAVLGEGNAALTHM
GKSGLERYYEQDLRGQVGYEQVETNVQGRAIRTVGRVAPQSGADLRLSVD
ADLQRAMVAAFGEHEGAAIAMDPRTGEILGMVSLPSYDPNLFVNGISHTD
FKMLNDNPSRPQFNRLVLGGVAPGSTLKPLIALAGLDSGLRRPEDRVLST
GMFYLPGVSRGWGDSHRGGHGWTDLRKSIAQSVNTYYYRLAVDMGIERFD
RYLGDYGFGQPTGVDLLGEIGGILPSPAYKYKTRKERWYPGDTVNIAIGQ
GDWKVTPLQLVRGISATASGLLLRPHLVLEERTGFDHPWQPMIQPPGKPI
STNAAHLQAVREGMMDTMRPGGTGYAITPGAPYQMAGKTGTAQVVSRKGV
AAVDPRSLPMHLRHRGLFVGFAPADNPVIAVAVAVEGGGFGTSSAAPIAR
KIFDAWLLGKMPAGLEPLDSELGMTAVGVNQFEAGVTDARAAGDAAAATL
DELPVVIGQTAVALDPNTPAQPVVPDVPDAVQETDH
XFF4834R

XFF4834R_chr07780 lcl|ftsI-XFF4834R_chr07780

3

607

S=329 I=28 E=5.23996e-33

transpeptidase involved in septal peptidoglycan synthesis (penicillin-binding protein 3)

XFF4834R

XFF4834R_chr12650 lcl|mrcA-XFF4834R_chr12650

312

408

S=97 I=27 E=6.76614e-05

fused penicillin-binding protein 1a: murein transglycosylase/murein transpeptidase

XFF4834R

NP_641012.1 lcl|mrdA-XAC0659

1

686

S=3237 I=91 E=0

penicillin-binding protein 2

XFF4834R

YP_362451.1 lcl|mrdA-XCV0720

1

686

S=3235 I=91 E=0

penicillin-binding protein 2

XFF4834R

NP_638813.1 lcl|mrdA-XCC3467

1

667

S=3172 I=91 E=0

penicillin-binding protein 2

XFF4834R

lcl|mrdA-XALc_0808

1

662

S=2556 I=74 E=0

probable penicillin-binding protein.

XFF4834R

lcl|ftsI-XALc_2819

16

607

S=351 I=28 E=4.82553e-35

probable cell division protein ftsi

XFF4834R

NP_641126.1 lcl|ftsI-XAC0774

3

607

S=327 I=28 E=3.73808e-32

penicillin-binding protein 3

XFF4834R

YP_362556.1 lcl|ftsI-XCV0825

16

607

S=324 I=27 E=8.9392e-32

cell division protein FtsI

XFF4834R

NP_636111.1 lcl|ftsI-XCC0720

3

607

S=317 I=27 E=6.30196e-31

penicillin-binding protein 3

pubmed

8

604

S=1089 I=38 E=6.91585e-123

Penicillin-binding protein 2 ; Antibiotic resistance Cell inner membrane shape wall biogenesis/degradation Multifunctional enzyme Peptidoglyca

Pubmed 8930920

 

prodomImg

pubmed

12

609

S=1060 I=37 E=2.31783e-119

Penicillin-binding protein 2 Peptidoglycan synthetase penicillin-binding protein 2

Pubmed 16751270

 

prodomImg

pubmed

12

609

S=1060 I=37 E=2.31783e-119

Penicillin-binding protein 2 ; Antibiotic resistance Cell inner membrane shape wall biogenesis/degradation Multifunctional enzyme Peptidoglycan

Pubmed 3533535

 

prodomImg

pubmed

12

609

S=1049 I=37 E=5.88674e-118

Strongly similar to penicillin-binding protein 2 (PBP-2)

Pubmed 16563686

 

prodomImg

pubmed

4

620

S=848 I=35 E=1.17941e-93

Pbp2 protein

Pubmed 15601688

 

prodomImg

sp_Pdown

sp|P74872|PBP2_SALTY

8

604

S=1089 I=38 E=4.70756e-123

Penicillin-binding protein 2 ; Antibiotic resistance Cell inner membrane shape wall biogenesis/degradation Multifunctional enzyme Peptidoglyca

sp_Pdown

sp|P44469|PBP2_HAEIN

8

612

S=1066 I=36 E=2.83198e-120

Penicillin-binding protein 2 ; Antibiotic resistance Cell inner membrane shape wall biogenesis/degradation Multifunctional enzyme Peptidoglycan synthe

sp_Pdown

sp|P0AD65|PBP2_ECOLI

12

609

S=1060 I=37 E=1.57773e-119

Penicillin-binding protein 2 ; Antibiotic resistance Cell inner membrane shape wall biogenesis/degradation Multifunctional enzyme Peptidoglycan

sp_Pdown

sp|P0AD66|PBP2_ECOL6

12

609

S=1060 I=37 E=1.57773e-119

Penicillin-binding protein 2 ; Antibiotic resistance Cell inner membrane shape wall biogenesis/degradation Multifunctional enzyme Peptidoglycan synth

sp_Pdown

sp|P0AD67|PBP2_ECO57

12

609

S=1060 I=37 E=1.57773e-119

Penicillin-binding protein 2 ; Antibiotic resistance Cell inner membrane shape wall biogenesis/degradation Multifunctional enzyme Peptidoglyc

Iprscan [G3DSA:3.40.710.10]

248

604

-

Iprscan IPR001460 [PF00905]

266

604

Penicillin-binding protein, transpeptidase

Iprscan IPR005311 [PF03717]

65

233

Penicillin-binding protein, dimerisation domain

Iprscan IPR017790 [TIGR03423]

19

609

Penicillin-binding protein 2

Iprscan [seg]

118

127

-

Iprscan [seg]

580

589

-

Iprscan [seg]

634

649

-

Iprscan [seg]

669

682

-

Iprscan [SignalP-NN(euk)]

1

37

-

Iprscan [tmhmm]

21

40

-

PD770102

240

339

S=225 I=48 E=1.13545e-19

PDA1L2Z8

338

376

S=197 I=90 E=3.16875e-16

PD162287

377

443

S=174 I=47 E=1.73194e-13

PDA1L1S4

610

685

S=166 I=51 E=1.92135e-12

PDA3X8C6

8

93

S=157 I=35 E=2.20713e-11

PD326045

167

247

S=153 I=49 E=6.22906e-11

PDA1F2G8

93

162

S=145 I=41 E=6.11627e-10

PD002485

68

245

S=141 I=29 E=1.6816e-09

PDA1K6Z3

67

97

S=140 I=87 E=2.48951e-09

PD858844

500

572

S=138 I=43 E=4.31185e-09

Iprscan IPR012338 [SSF56601]

248

607

Beta-lactamase-type transpeptidase fold

Iprscan IPR005311 [SSF56519]

63

247

Penicillin-binding protein, dimerisation domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one u1OnyA2e)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

196 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr06680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr06680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr06680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr06680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
anmK XFF4834R_chr37860
XFF4834R_chr37850
XFF4834R_chr37850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37870
XFF4834R_chr37870
ID anmK
AC XFF4834R_chr37860
LT XFF4834R_chr37860
OR XFF4834R_chr from 4377244 to 4378377 on strand +
DE putative Anhydro-N-acetylmuramic acid kinase
IP Anhydro-N-acetylmuramic acid kinase
CL 6.2 Peptidoglycan (murein) GO:0009274
EC
GO InterPro
Biological Process: amino sugar metabolic process (GO:0006040)
Biological Process: peptidoglycan turnover (GO:0009254)
Molecular Function: ATP binding (GO:0005524)
alcohol group as acceptor (GO:0016773)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 39482.5 Da
SQ 377 aa
 
........10........20........30........40........50
| | | | |
MSVLEHVDSPLYLGLMSGTSADGIDAALVRFADATHRRCELVAGTTVAWE
PQLRETLVALGQGAETVAIDALGQLDAQVGLAFAAAANQLIGDSGVERRQ
IRAIGSHGQTIRHRPNANPAFTWQIGDASRIAEHTGITTVADFRRRDVAA
GGQGAPLMPAFHLAMLGAGDEDRAVLNLGGIGNLTLIPRDGAVRGFDTGP
ANALLDSWCQRHRGTPFDAEGAFAASGRVDAALLQALLADPWFALPPPKS
TGREQFHLDWAVQAMGNARLDAADVQATLLELTAASVADALLRLQPTTRR
VLVCGGGVRNPVLLARMAARLPGAMVESSARYGLDPDYLEAMGFAWLAAE
LMAGRAANLPSVTAAAGPRLLGAIYPA
Show or not Domain decomposition
 
XFF4834R

NP_644200.2 lcl|anmK-XAC3899

1

377

S=1771 I=93 E=0

anhydro-N-acetylmuramic acid kinase

XFF4834R

YP_365743.1 lcl|anmK-XCV4012

1

377

S=1753 I=91 E=0

anhydro-N-acetylmuramic acid kinase

XFF4834R

NP_639183.1 lcl|anmK-XCC3843

1

377

S=1580 I=83 E=0

anhydro-N-acetylmuramic acid kinase

XFF4834R

lcl|XALc_0381

8

377

S=1140 I=62 E=5.27923e-131

hypothetical protein

pubmed

1

374

S=728 I=44 E=1.8434e-79

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

Pubmed 16309397

 

prodomImg

pubmed

7

374

S=509 I=30 E=6.44197e-53

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

Pubmed 10988064

 

prodomImg

pubmed

12

261

S=430 I=39 E=2.71841e-43

Uncharacterized anhydro-N-acetylmuramic acid kinase-like protein

Pubmed 1732192

 

prodomImg

pubmed

104

374

S=354 I=37 E=4.63248e-34

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

Pubmed 18700039

 

prodomImg

pubmed

16

321

S=335 I=29 E=8.0101e-32

Anhydro-N-acetylmuramic acid kinase

Pubmed 18469101

 

prodomImg

sp_Pdown

sp|Q3BNC0|ANMK_XANC5

1

377

S=1753 I=91 E=0

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

sp_Pdown

sp|Q8PFS9|ANMK_XANAC

4

377

S=1750 I=92 E=0

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

sp_Pdown

sp|Q5H5K4|ANMK_XANOR

1

377

S=1694 I=89 E=0

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

sp_Pdown

sp|Q2P894|ANMK_XANOM

1

377

S=1694 I=89 E=0

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

sp_Pdown

sp|Q8P473|ANMK_XANCP

1

377

S=1580 I=83 E=0

Anhydro-N-acetylmuramic acid kinase EC=2.7.1.n1 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase

Iprscan IPR005338 [MF_01270]

10

377

Anhydro-N-acetylmuramic acid kinase

Iprscan IPR005338 [PF03702]

11

377

Anhydro-N-acetylmuramic acid kinase

Iprscan [seg]

176

187

-

Iprscan [seg]

231

239

-

PD017224

13

175

S=432 I=56 E=7.97336e-45

PD015894

240

358

S=300 I=48 E=8.73527e-29

PDA1F873

188

230

S=129 I=60 E=4.50255e-08

Iprscan [SSF53067]

9

354

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aeoCXiLD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

264 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr37860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr37860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr37860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrS7rXc/XFF4834R_chr37860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.