Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr00500XFF4834R_chr00520952_0064608_f1_XFF4834R-XFF4834R_chr00500XFF4834R_chr00500putative hemolysin-III family membrane protein
  2. XFF4834R_chr30600XFF4834R_chr30600putative penicillin amidase, pseudogene

XFF4834R_chr00520952_0064608_f1_XFF4834R-XFF4834R_chr00500 XFF4834R_chr00500
XFF4834R_chr00490
XFF4834R_chr00490
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00510
XFF4834R_chr00510
ID XFF4834R_chr00520952_0064608_f1_XFF4834R-XFF4834R_chr00500
AC XFF4834R_chr00500
LT XFF4834R_chr00500
OR XFF4834R_chr from 63952 to 64608 on strand +
DE putative hemolysin-III family membrane protein
IP Hly-III related
CL 5.6.3 Cell killing GO:0001906
EC
GO InterPro
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: acur
CC STATUS: curated by pieretti (20100413)
MW 23741.3 Da
SQ 218 aa
 
........10........20........30........40........50
| | | | |
MPANVTAPHYKSVSARRADIAVHAAGLLLAIVGGAWMVVRAHANQTMLLA
TCIYALGLLVMFACSAAYNFAPPQRQPMLRKFDHAGIFVMIAGSYTPFFL
VALDGTWRWVMILSVWCVALFGVFAKLCLPGIAKGFWVAIYLLLGWAGIV
VINQMIAGLDSAVLWLIVAGGAFYTVGVAFYVRKSMVYNRAIWHAHVLGG
ALSHWCAIWLCLRPLAEG
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr15970 lcl|XFF4834R_chr17190529_1844173_r3_XFF4834R-XFF4834R_chr15970

49

208

S=259 I=37 E=3.73212e-25

predicted oxidoreductase, inner membrane subunit

XFF4834R

XFF4834R_chr15970 lcl|XFF4834R_chr17190529_1844173_r3_XFF4834R-XFF4834R_chr15970

49

208

S=259 I=37 E=3.73212e-25

predicted oxidoreductase, inner membrane subunit

XFF4834R

NP_640435.1 lcl|XAC0079-XAC0079

1

218

S=1025 I=92 E=2.4853e-117

hemolysin III

XFF4834R

YP_361787.1 lcl|XCV0056

1

218

S=1022 I=92 E=4.86339e-117

hemolysin-III family membrane protein

XFF4834R

NP_635451.2 lcl|XCC0056

1

217

S=910 I=81 E=2.13657e-103

hemolysin III

XFF4834R

lcl|XALc_3106

3

217

S=759 I=67 E=3.77472e-85

putative hemolysin-III family membrane protein

XFF4834R

lcl|XALc_2189

49

208

S=276 I=37 E=1.18741e-26

putative predicted membrane protein, hemolysin III homolog

XFF4834R

NP_638208.1 lcl|hly3-XCC2860

47

208

S=260 I=36 E=1.06767e-24

hemolysin III

XFF4834R

YP_364911.1 lcl|XCV3180

49

208

S=260 I=37 E=1.3277e-24

hemolysin-III family membrane protein

XFF4834R

NP_643352.1 lcl|hly3-XAC3043

49

208

S=259 I=37 E=1.37482e-24

hemolysin III

pubmed

42

215

S=317 I=39 E=5.36255e-30

Hemolysin III

Pubmed 14742502,15386100

 

prodomImg

pubmed

12

198

S=306 I=37 E=1.25917e-28

Chemotaxis histidine kinase

Pubmed 11934495

 

prodomImg

pubmed

48

214

S=256 I=35 E=1.40325e-22

Putative hemolysin-III related protein precusor

Pubmed 16980464

 

prodomImg

pubmed

74

213

S=226 I=35 E=5.36004e-19

Hemolysin-3 homolog ; Cell membrane Transmembrane

Pubmed 8969496

 

prodomImg

pubmed

42

212

S=223 I=29 E=1.27067e-18

Hemolysin-3 ; Cell membrane Cytolysis Hemolysis Toxin Transmembrane

Pubmed 7495855

 

prodomImg

pubmed

49

212

S=184 I=34 E=6.13676e-14

Putative uncharacterized protein

Pubmed 15640215

 

prodomImg

pubmed

53

212

S=125 I=29 E=1.03843e-06

Monocyte to macrophage differentiation factor 2 ; Membrane Receptor Transmembrane

Pubmed 12617826,16044242

 

prodomImg

sp_Pdown

sp|P67156|YQFA_SHIFL

39

210

S=316 I=39 E=4.8566e-30

UPF0073 inner membrane protein yqfA ; Cell Transmembrane

sp_Pdown

sp|P67153|YQFA_ECOLI

39

210

S=316 I=39 E=4.8566e-30

UPF0073 inner membrane protein yqfA ; Cell Transmembrane

sp_Pdown

sp|P67154|YQFA_ECOL6

39

210

S=316 I=39 E=4.8566e-30

UPF0073 inner membrane protein yqfA ; Cell Transmembrane

sp_Pdown

sp|P67155|YQFA_ECO57

39

210

S=316 I=39 E=4.8566e-30

UPF0073 inner membrane protein yqfA ; Cell Transmembrane

sp_Pdown

sp|P54175|HLY3_BACSU

74

213

S=226 I=35 E=3.70466e-19

Hemolysin-3 homolog ; Cell membrane Transmembrane

PD150356

42

171

S=216 I=36 E=9.07422e-19

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ftVUUOJq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr00500.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr00500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr00500.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr00500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr30600

Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence

ID
AC XFF4834R_chr30600
LO XFF4834R_chr30600
DE putative penicillin amidase, pseudogene
CL 5.6.3 Cell killing GO:0001906
GO InterPro
Biological Process: antibiotic biosynthetic process (GO:0017000)
Molecular Function: hydrolase activity (GO:0016787)
in linear amides (GO:0016811)

Curated
PM
AN previous XFF4834R_chr_3233 and XFF4834R_chr_3234 have been deleted as they corresponded to 2 fragments of a gene (stop at position 3517962 and start at position 3517972). Orthologs in other Xanthomonas are Xacm1425, Xcv1494, Xoc3050, XccB100-2905....
CC MODEL:
CC STATUS: curated by darrasse (20120928)
SQ 2418 nt
 
........10........20........30........40........50
| | | | |
ATGCGTCAATGGCTGGGCCGGCTGCTGCTGGGAATCGGGTTGCTGGTCCT
GGCGGCCAGCCTGGGGCTGTATCTGTTGATGCGCGGCAGCCTGCCGCAGT
TGGACGGCGACAGCGCGCTCAGCGGCCTGGCTGCGCCGGTCAGCGTGCAG
CGCGACCGGCTGGGCGTGGTCACCATCGATGCAGCAAACCAGCTCGATGC
GATGCGTGCGCTCGGCTACGTGCATGCGCAGGAACGCTATTTCGAGATGG
ATCTGATGCGCCGCGCACCGGCCGGCGAGTTGTCCGAGCTGTTTGGCGCC
AAGGCCGTGGACCTGGACAAGCGCAACCGCGCGCATCGCCTGCGCGCGCG
CGTGCAGGCCAGCCTGGATATCGCCACCGGCAGTCAGCGCGCCGCATTGC
AAGCGTATACCGATGGCGTCAATGCAGGACTGGCAGCACTGCGCGTACGG
CCCTGGCCCTATCTGCTGCTGCGCCAGACACCGCGTGCGTGGACGCTGGA
CGACTCCATCCTCACCGGCCTTGCGATGTACGCAGACCTGCAGGACAGCG
ACAACCAGACCGAGCTGGCCGCTGCGCGCATCCGTGCCGTGGTACCCCCT
GCGCTGGCGGCACTGTTCGACCATCAGGGCTCCAGTTGGGACGCGCCGTT
GTCCGGGCCGCCACAAGGCGATGCCAGCGTGCCGGATGCGGCCACGCTGG
ACCTACGGCGTCTACCGCATCCGCCTGCCGCGCCACACGCGGAAACGCCG
ACGCCGGGCAGCAACAACTTCGCGGTAGACGGCAGCCTCACCGCCGACGG
CCGCGCCATCGTTGCCGACGACATGCACCTGGGCCTGCGCGCGCCCAATA
TCTGGTTCCGCGCACGCATGCGCTATGCAGACAGCAATGCGCCCGAGGGC
AAGGTGGATGTCACCGGATTCACCCTGCCGGGTCTGCCGGCGGTGGTCGT
GGGCAGCAACGGGCATGTGGCTTGGGCATTTACCAACAGTTACATCGACA
CTGCGGATTTCGCGCGCATTCCCGCACCTACACCGGGTCACCCACAGGCA
CTGACCAGGCACGTGGAAACCATCCGCGTGGCGGGCGCAGCGCCGGTGCA
GTTCGAGGTCCGTGAAGCGACGTGAGGACCGGTATTGCACGTCAACGCCG
ACGGCAGCGCGCTGGCATTGCGCTGGGCGGCGCAGTTGCCCGGTGCGATC
CGGTTGGACTTCGCCCAGATGAGCACGGCGGGCGATCTGCAGGCGGCGTT
TGCGGTGGCCGACCGCTCCGGCATTCCGGCGCAGAACCTGCTGCTTGCTG
ATCGCAGCGGGCGCATCGCCTGGCGCCTGATCGGCGCGCGCCCCGCGCGC
AATGCCGGGTGCGGCCCGAGCGGGATTGCCGAATTGGCGACATCGACGCC
CGCACCTGAGGCAGCATCCAGCGCACCTGCAGAGACGGCTGCAACGCCTT
CGATGTCGGGCACCTGCCTGCCATGGTCGCTGCGCAGCGATGCTGCGCCT
GCGTTGATCGATCCGCCGTCGCACCGGCTCTGGACCGCCAACAACCGTAT
CGTCGATGCGCAACAACTGGCCACGCTTGGCAACGCAGGTTACGACCTTG
GCGCGCGTGCGCAGCAGATTCGCGAGGATCTTTTCGCAAAGCAGCGCTTC
AACGAACGCGATCTGCTCGCCATCCAGCTCGACGATCGCGCCGTGCTGCT
CACGCGCTGGTGGCAACTGCTGCGTAGCGTGGTCGAGCACAGCAAGGATC
CGGCGCTGCAACAGGTTGCACACGCCACGCGCCACTGGGATGGGCGCGCA
TCGACTGACTCGGCCAGCTATCGCATCGTGCGCGAATTTCGCAGCAAGAC
CATCGAGGCGGTGGAAGCCGGCCTGCTGGCACCGGCAAAAGCCGCACTTG
GCGCGGAGTTCCTGCCGCCACGTCGCGCGCAACTGGAGGGCATCGTCTGG
CCGTTGCTGCAACAGCGCCCGGCCCACCTGTTGTCGCCCGCCGTCGCAAG
TTGGGAGCAGTTGCTCGACGATGCCGCGCGCAGAGCGCAGTCAGACATGA
TTGCTGAAGACGCGCAAAGCGAACCGCGCGGCCAGCACACCTGGGGCCAG
CGCAACACCGCCTCCATCTGCCACCCCATTGCGCGTGCACTGCCCGCCCT
GGCCAAGCGCTGGCTCTGCATGCCGCCCGATCAACTGCCGGGCGACCGCG
ACATGCCGCGCGTGCAAGGCCCGGCCTTTGGCGCCTCCGAGCGCATGGTG
GTTTTGCCCGGCCACGAGCAGGACGGCATCGTGCACATGCCCGGCGGCCA
GAGCGGCCACCCGCTTTCGCCGTTCTGGGGCGCGGGGCACGACGATTGGG
TGCATGGCAGACCCACACCATTTTTGCCCACTGCCACGCGTTACACGCTG
CAACTGCGTCCGCAGTAA
Show or not Domain decomposition
 
Iprscan IPR023343 [G3DSA:1.10.439.10]

42

181

Peptidase S45, penicillin amidase type, domain1

Iprscan [G3DSA:3.60.20.10]

254

338

-

Iprscan [G3DSA:3.60.20.10]

28

266

-

Iprscan IPR002692 [PF01804]

46

373

Peptidase S45, penicillin amidase

Iprscan IPR002692 [PF01804]

1

415

Peptidase S45, penicillin amidase

Iprscan [seg]

5

26

-

Iprscan [seg]

190

205

-

Iprscan [seg]

239

252

-

Iprscan [seg]

85

109

-

Iprscan [seg]

245

263

-

Iprscan [seg]

23

36

-

Iprscan [seg]

90

101

-

Iprscan [seg]

154

173

-

Iprscan [seg]

1

15

-

Iprscan [seg]

2

11

-

Iprscan [seg]

2

15

-

Iprscan [seg]

25

47

-

Iprscan [seg]

10

26

-

Iprscan [seg]

46

58

-

Iprscan [seg]

34

60

-

Iprscan [seg]

64

76

-

Iprscan [seg]

103

122

-

Iprscan [seg]

142

161

-

Iprscan [seg]

235

246

-

Iprscan [seg]

251

281

-

Iprscan [seg]

309

325

-

Iprscan [seg]

6

23

-

Iprscan [seg]

38

48

-

Iprscan [seg]

82

105

-

Iprscan [seg]

48

63

-

Iprscan [seg]

44

56

-

Iprscan [seg]

61

88

-

Iprscan [seg]

66

77

-

Iprscan [seg]

98

114

-

Iprscan [seg]

174

188

-

Iprscan [seg]

192

218

-

Iprscan [seg]

223

236

-

Iprscan [seg]

405

442

-

Iprscan [seg]

45

58

-

Iprscan [seg]

133

144

-

Iprscan [seg]

192

215

-

Iprscan [seg]

218

231

-

Iprscan [seg]

22

62

-

Iprscan [seg]

98

116

-

Iprscan [seg]

141

158

-

Iprscan [seg]

98

120

-

Iprscan [seg]

131

141

-

Iprscan [seg]

31

40

-

Iprscan [seg]

17

28

-

Iprscan [seg]

10

25

-

Iprscan [seg]

21

37

-

Iprscan [seg]

64

76

-

Iprscan [seg]

24

35

-

Iprscan [seg]

38

55

-

Iprscan [seg]

48

71

-

Iprscan [seg]

40

64

-

Iprscan [seg]

4

21

-

Iprscan [seg]

7

29

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [SignalP-NN(euk)]

1

23

-

Iprscan [SignalP-NN(euk)]

1

24

-

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [tmhmm]

5

27

-

Iprscan [SSF56235]

42

372

-

Iprscan [SSF56235]

1

430

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8iWd52cg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr30600.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr30600.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr30600.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaKjNBP/XFF4834R_chr30600.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.