Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr01910XFF4834R_chr02030518_0227952_f1_XFF4834R-XFF4834R_chr01910XFF4834R_chr01910putative rhodanese-like protein
  2. XFF4834R_chr32350katGXFF4834R_chr32350probable haem-containing catalase-peroxidase
  3. XFF4834R_chr33290katEXFF4834R_chr33290catalase
  4. XFF4834R_chr36190XFF4834R_chr39350549_4191448_f2_XFF4834R-XFF4834R_chr36190XFF4834R_chr36190putative manganese-containing catalase

XFF4834R_chr02030518_0227952_f1_XFF4834R-XFF4834R_chr01910 XFF4834R_chr01910
XFF4834R_chr01900
XFF4834R_chr01900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01920
XFF4834R_chr01920
ID XFF4834R_chr02030518_0227952_f1_XFF4834R-XFF4834R_chr01910
AC XFF4834R_chr01910
LT XFF4834R_chr01910
OR XFF4834R_chr from 227518 to 227952 on strand +
DE putative rhodanese-like protein
IP Rhodanese-like
CL 5.6.2 Detoxification (xenobiotic metabolism) GO:0006805
EC
GO InterPro


Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100426)
MW 15379.8 Da
SQ 144 aa
 
........10........20........30........40........50
| | | | |
MNFEELQAFVGRNPMLSLALVGLTIALIVTEVARLFRGYRALKPAELTRL
INSENALVIDLSPTADFEKGHIAGSRNVALAKFDPAGKLLANAKASPVVV
VCRSGTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR
XFF4834R

XFF4834R_chr21260 lcl|moeB-XFF4834R_chr21260

42

142

S=112 I=30 E=1.51803e-07

molybdopterin synthase sulfurylase

XFF4834R

XFF4834R_chr21260 lcl|moeB-XFF4834R_chr21260

42

142

S=112 I=30 E=1.51803e-07

molybdopterin synthase sulfurylase

XFF4834R

YP_361936.1 lcl|XCV0205

1

144

S=741 I=100 E=2.98742e-83

putative rhodanese-like membrane protein

XFF4834R

NP_640576.1 lcl|XAC0220-XAC0220

1

144

S=741 I=100 E=2.98742e-83

hypothetical protein

XFF4834R

NP_635597.1 lcl|XCC0202

1

144

S=718 I=94 E=1.67609e-80

hypothetical protein

XFF4834R

lcl|XALc_3080

1

144

S=565 I=73 E=6.21325e-62

hypothetical rhodanese-like membrane protein

XFF4834R

YP_363805.1 lcl|moeB-XCV2074

42

142

S=112 I=30 E=5.43884e-07

molybdopterin biosynthesis protein MoeB

XFF4834R

NP_642349.1 lcl|moeB-XAC2023

42

142

S=109 I=30 E=1.26706e-06

molybdopterin biosynthesis protein MoeB

XFF4834R

NP_637354.1 lcl|moeB-XCC1989

42

142

S=103 I=28 E=6.03368e-06

molybdopterin biosynthesis protein MoeB

pubmed

3

144

S=274 I=43 E=3.80123e-25

Uncharacterized protein yibN ; Acetylation

Pubmed 8041620

 

prodomImg

pubmed

38

136

S=133 I=42 E=4.70119e-08

CR027 protein Predicted protein

Pubmed 12836870

 

prodomImg

pubmed

39

134

S=124 I=28 E=6.04858e-07

Thiosulfate sulfurtransferase glpE EC=2.8.1.1 ; Cytoplasm Glycerol metabolism

Pubmed 8955387,3045764

 

prodomImg

pubmed

28

140

S=121 I=31 E=1.24719e-06

Putative uncharacterized protein ; Plasmid

Pubmed 15240330

 

prodomImg

pubmed

41

144

S=118 I=37 E=2.68625e-06

Putative uncharacterized protein ; Plasmid

Pubmed 15240330

 

prodomImg

pubmed

51

133

S=117 I=29 E=3.8072e-06

ANL35 Putative uncharacterized protein ; Plasmid

Pubmed 18353436

 

prodomImg

pubmed

39

140

S=116 I=25 E=4.85991e-06

Thiosulfate sulfurtransferase glpE EC=2.8.1.1 ; Cytoplasm Glycerol metabolism

Pubmed 14742511

 

prodomImg

pubmed

53

133

S=115 I=38 E=6.25802e-06

Putative uncharacterized protein ; Plasmid Transferase

Pubmed 18511120

 

prodomImg

pubmed

55

139

S=108 I=33 E=5.02819e-05

Putative uncharacterized protein ; Plasmid

Pubmed 15240330

 

prodomImg

sp_Pdown

sp|P0AG27|YIBN_ECOLI

3

144

S=274 I=43 E=2.66955e-25

Uncharacterized protein yibN ; Acetylation

sp_Pdown

sp|P0AG28|YIBN_ECOL6

3

144

S=274 I=43 E=2.66955e-25

Uncharacterized protein yibN ; Acetylation

sp_Pdown

sp|P0AG29|YIBN_ECO57

3

144

S=274 I=43 E=2.66955e-25

Uncharacterized protein yibN ; Acetylation

sp_Pdown

sp|P44854|Y744_HAEIN

9

144

S=191 I=32 E=3.29211e-15

Uncharacterized protein HI0744

sp_Pdown

sp|Q3IHW1|GLPE_PSEHT

39

136

S=163 I=32 E=7.38807e-12

Thiosulfate sulfurtransferase glpE EC=2.8.1.1 ; Cytoplasm Glycerol metabolism

PD280225

35

141

S=168 I=33 E=6.36696e-13

PDA1N6B5

4

78

S=146 I=36 E=3.10707e-10

PDA1O6G1

60

96

S=128 I=68 E=4.20875e-08

PDA8E2Z2

34

83

S=123 I=50 E=2.0573e-07

PD602401

40

138

S=119 I=36 E=6.55997e-07

PD799304

81

143

S=116 I=37 E=1.31772e-06

PDA9D617

53

143

S=106 I=35 E=2.22152e-05

PDA1A1I8

50

136

S=106 I=34 E=2.44513e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one S0tzzRD4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

83 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr01910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr01910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr01910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr01910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
katG XFF4834R_chr32350
XFF4834R_chr32340
XFF4834R_chr32340
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32360
XFF4834R_chr32360
ID katG
AC XFF4834R_chr32350
LT XFF4834R_chr32350
OR XFF4834R_chr from 3721970 to 3724216 on strand +
DE probable haem-containing catalase-peroxidase
IP Haem peroxidase
CL 5.6.2 Detoxification (xenobiotic metabolism) GO:0006805
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: response to oxidative stress (GO:0006979)
Molecular Function: peroxidase activity (GO:0004601)
Molecular Function: catalase activity (GO:0004096)
Molecular Function: heme binding (GO:0020037)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100830)
MW 81983.8 Da
SQ 748 aa
 
........10........20........30........40........50
| | | | |
MTTEAKCPFNHAVVGTGTTNRDWWPKQLRVDLLSQHSSKSNPLGPSFNYA
DAFKRLDLQALKQDLHALMTDSQDWWPADFGHYGPLFVRMAWHSAGTYRI
GDGRGGGGRGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGQAISWADLM
ILTGNIALESMGLKTFGFAGGREDTWEPDQDLYWGRETKWLGGDERYSRG
SPGVDEAHGVLVKDDDSQVPHTRDLENPLAAVQMGLIYVNPEGPDGNPDP
IASARDIRDTFARMAMNDEETVALIAGGHTFGKTHGAGPADNVGAEPEAG
ELESQGFGWHNRYGSGKGADTITSGLEVTWTTTPAQWSNDYFDHLFGFEW
ELSKSPAGAHQWVAKDADAIIPDAHDASRKHRPTMLTTDLALRFDPAYEA
ISRRFQQHPEQFADAFARAWFKLTHRDMGPRARYLGADVPAEELVWQDPV
PAVDHALVDAQDAAALKQTVLASGLSVAHLVSTAWASASTFRGSDKRGGA
NGARIRLAPQKEWQANQPEQLAKVLATLERIQADFNATQSGGKKISLADL
IVLAGNAAVEHAAQAAGHQVTVPFAPGRTDASQEQTDVESFAVLEPVADG
FRNFAKRRYAVPAEALLIDKAQLLTLTAPELTVLVGGLRVLGANVDDSKN
GVFTSRPGVLSNDFFANLLDMRTEWKATSEAKDVFEGRDRSTGDLRWTGT
RVDLVFGSNSILRAVAEVYASADAQEKFVHDFVAAWTKVMQLDRFDLT
XFF4834R

NP_641636.2 katG-XAC1301

1

747

S=3569 I=91 E=0

catalase

XFF4834R

YP_363081.1 katG-XCV1350

1

747

S=3549 I=90 E=0

catalase

XFF4834R

NP_636579.1 katG-XCC1205

1

747

S=3222 I=82 E=0

catalase/peroxidase

XFF4834R

XALc_0959 katG-XALc_0959

1

747

S=2790 I=72 E=0

probable peroxidase/catalase protein

pubmed

1

747

S=2756 I=70 E=0

Catalase-peroxidase 2 EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

Pubmed 17371508

 

prodomImg

pubmed

1

747

S=2746 I=71 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

Pubmed 12383513

 

prodomImg

pubmed

1

747

S=2700 I=70 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

Pubmed 15942004

 

prodomImg

pubmed

1

747

S=2696 I=70 E=0

Iron (III) protoporphyrin IX monomer binding protein

Pubmed 12686627

 

prodomImg

pubmed

1

747

S=2681 I=68 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

Pubmed 17853511

 

prodomImg

sp_Pdown

acc=Q8PMX4

1

747

S=3569 I=91 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

sp_Pdown

acc=Q3BVY2

1

747

S=3549 I=90 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

sp_Pdown

acc=Q8PBB7

1

747

S=3222 I=82 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

sp_Pdown

acc=B0RXD3

1

747

S=3222 I=82 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

sp_Pdown

acc=Q4US88

1

747

S=3222 I=82 E=0

Catalase-peroxidase EC=1.11.1.6 EC=1.11.1.7 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase

Iprscan IPR000763 [PR00460]

20

42

Catalase-peroxidase haem

Iprscan IPR000763 [PR00460]

46

59

Catalase-peroxidase haem

Iprscan IPR000763 [PR00460]

61

86

Catalase-peroxidase haem

Iprscan IPR000763 [PR00460]

88

106

Catalase-peroxidase haem

Iprscan IPR000763 [PR00460]

112

136

Catalase-peroxidase haem

Iprscan IPR000763 [PR00460]

137

160

Catalase-peroxidase haem

Iprscan IPR000763 [PR00460]

346

362

Catalase-peroxidase haem

Iprscan IPR000763 [PR00460]

492

518

Catalase-peroxidase haem

Iprscan IPR002016 [PR00458]

84

98

Haem peroxidase, plant/fungal/bacterial

Iprscan IPR002016 [PR00458]

144

161

Haem peroxidase, plant/fungal/bacterial

Iprscan IPR002016 [PR00458]

162

174

Haem peroxidase, plant/fungal/bacterial

Iprscan IPR002016 [PR00458]

330

345

Haem peroxidase, plant/fungal/bacterial

Iprscan [G3DSA:1.10.520.10]

43

216

-

Iprscan [G3DSA:1.10.420.10]

253

419

-

Iprscan [G3DSA:1.10.520.10]

453

619

-

Iprscan IPR000763 [MF_01961]

1

748

Catalase-peroxidase haem

Iprscan IPR002016 [PF00141]

69

407

Haem peroxidase, plant/fungal/bacterial

Iprscan IPR002016 [PF00141]

414

721

Haem peroxidase, plant/fungal/bacterial

Iprscan IPR000763 [TIGR00198]

4

748

Catalase-peroxidase haem

Iprscan IPR019793 [PS00435]

271

281

Peroxidases heam-ligand binding site

Iprscan IPR019794 [PS00436]

84

95

Peroxidase, active site

Iprscan IPR002016 [PS50873]

126

442

Haem peroxidase, plant/fungal/bacterial

Iprscan [seg]

101

113

-

Iprscan [seg]

364

377

-

Iprscan [seg]

554

570

-

Iprscan [seg]

633

642

-

PDA1F719

229

303

S=354 I=88 E=2.93076e-35

PD593509

528

629

S=308 I=63 E=1.3898e-29

PD001849

385

445

S=274 I=80 E=1.49823e-25

PDA1F737

678

748

S=265 I=72 E=2.17789e-24

PD001852

446

544

S=238 I=50 E=3.30142e-21

PD001852

87

147

S=182 I=58 E=2.5489e-14

PD419358

5

56

S=171 I=55 E=5.29733e-13

PDA1F721

307

349

S=166 I=67 E=1.94199e-12

PDA1F722

148

198

S=152 I=72 E=1.00817e-10

PDA1F7B0

57

87

S=139 I=81 E=3.7907e-09

Iprscan IPR010255 [SSF48113]

9

443

Haem peroxidase

Iprscan IPR010255 [SSF48113]

441

748

Haem peroxidase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PbzJ3cv3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

272 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

28 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr32350.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr32350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr32350.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr32350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
katE XFF4834R_chr33290
XFF4834R_chr33280
XFF4834R_chr33280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3522
XFF4834R_chr_3522
ID katE
AC XFF4834R_chr33290
LT XFF4834R_chr33290
OR XFF4834R_chr from 3829570 to 3831678 on strand +
DE catalase
IP Catalase-like domain, haem-dependent
CL 5.6.2 Detoxification (xenobiotic metabolism) GO:0006805
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: response to oxidative stress (GO:0006979)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: heme binding (GO:0020037)
Molecular Function: catalase activity (GO:0004096)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100830)
MW 76503.4 Da
SQ 702 aa
 
........10........20........30........40........50
| | | | |
MAKSPSKSAQLPALAPASATVDVSRGTGDELHQKAGGTHPQLTTNQGIPV
GDNQNSLRATPRGPTLLEDFILREKITHFDHERIPERIVHARGSAAHGYF
ELTKSLSQYTTAKIFTEVGEKTPLFTRFSTVAGGAGSVDTPRDVRGFAVK
FYTKEGNWDLVGNNIPVFFIQDAMKFPDLIHAVKMEPDRGFPQAASAHDT
FWDFISLTPESMHMVMWAMSDRTIPRSLRMIEGFGIHSFRFLNDKGESTF
VKFHWRPKLGLQSTIWDEAVKIAGADQDFHRRDLFEAIQNGDFPEWELGV
QLFTQAQAETFPFDHLDSTKVIPEELVPLQIVGRMVLDRWPDNFFAETEQ
VAYCPANIVPGIDFSNDPLLQGRLFSYLDTQLSRLGGPNFHQIPINTPKC
PFANNQRDGHMQMGVPKGRVAYEPSSLQADAPREALRGFPSHATPAEEGA
KGRVRAESFADHYSQARLFFRSQTAPEQAHIASALVFELSKVETAHVREA
IVGHLRHIDQELAQRVADGMGMTALPPAPPAAVAPIDMPLSPALQVIGKM
KDTLKGRTVGILIHDGSDAAAIKAVRKAAEAAGATVKIVAPKLGGAKLND
GKQLAADGQLAGTPSVVFDAVAVLLSSEAAKLLTRESAALDFVSFAWAHL
KAIAFDEGAQSLLKAGNVGKDAGVVPAADTKAFIAAAKTRQWAREPKVRM
LA
XFF4834R

XFF4834R_chr38960 XFF4834R_chr42100511_4487034_r1_XFF4834R-XFF4834R_chr38960

42

519

S=903 I=42 E=1.41569e-102

XFF4834R

NP_641547.1 katE-XAC1211

20

702

S=3326 I=92 E=0

catalase

XFF4834R

YP_362971.1 katE-XCV1240

1

702

S=3303 I=89 E=0

catalase

XFF4834R

NP_636484.1 katE-XCC1109

25

702

S=3187 I=88 E=0

catalase

XFF4834R

NP_639288.1 catB-XCC3949

42

519

S=905 I=42 E=2.99821e-102

catalase precursor

XFF4834R

XALc_2991 catB-XALc_2991

36

495

S=905 I=42 E=3.3e-102

probable catalase precursor protein

XFF4834R

YP_365853.1 catB-XCV4122

42

428

S=900 I=47 E=1.4784e-101

catalase precursor

XFF4834R

NP_644328.1 catB-XAC4029

134

519

S=656 I=39 E=5.77205e-72

catalase precursor

XFF4834R

NP_644329.1 catB-XAC4030

42

126

S=229 I=55 E=3.08159e-20

catalase

XFF4834R

NP_639245.1 srpA-XCC3905

87

377

S=169 I=26 E=5.16924e-13

catalase

XFF4834R

XALc_0265 XALc_0265

87

380

S=167 I=24 E=8.95316e-13

hypothetical catalase precursor protein

XFF4834R

YP_365814.1 srpA-XCV4083

87

377

S=147 I=24 E=2.47897e-10

catalase

XFF4834R

NP_644290.1 srpA-XAC3990

87

377

S=137 I=23 E=3.93182e-09

catalase

pubmed

1

702

S=3326 I=90 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 10675038

 

prodomImg

pubmed

24

702

S=3221 I=89 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 8655557

 

prodomImg

pubmed

25

671

S=2011 I=60 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 18838821

 

prodomImg

pubmed

24

700

S=2011 I=58 E=0

Catalase C EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Plasmid

Pubmed 10198032,11481431

 

prodomImg

pubmed

30

675

S=1779 I=54 E=0

Catalase EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Pubmed 14555490

 

prodomImg

sp_Pdown

acc=Q9X576

24

700

S=2011 I=58 E=0

Catalase C EC=1.11.1.6 ; Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Plasmid

sp_Pdown

acc=Q9I1W8

42

675

S=1731 I=54 E=0

Catalase HPII EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

sp_Pdown

acc=P95539

34

655

S=1716 I=54 E=0

Catalase HPII EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

sp_Pdown

acc=P21179

34

655

S=1668 I=53 E=0

Catalase HPII EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

sp_Pdown

acc=P30266

41

675

S=1663 I=51 E=0

Catalase EC=1.11.1.6 ; Cytoplasm Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase

Iprscan IPR018028 [PR00067]

56

79

Catalase related subgroup

Iprscan IPR018028 [PR00067]

119

137

Catalase related subgroup

Iprscan IPR018028 [PR00067]

140

157

Catalase related subgroup

Iprscan IPR018028 [PR00067]

159

177

Catalase related subgroup

Iprscan IPR018028 [PR00067]

328

355

Catalase related subgroup

Iprscan IPR018028 [PR00067]

360

386

Catalase related subgroup

Iprscan IPR011614 [G3DSA:2.40.180.10]

30

539

Catalase, N-terminal

Iprscan [G3DSA:3.40.50.880]

548

695

-

Iprscan IPR020835 [PTHR11465]

118

675

Catalase-like domain, haem-dependent

Iprscan IPR018028 [PF00199]

43

429

Catalase related subgroup

Iprscan IPR010582 [PF06628]

453

521

Catalase-related immune responsive

Iprscan IPR002226 [PS00437]

373

381

Catalase

Iprscan IPR002226 [PS00438]

79

95

Catalase

Iprscan IPR011614 [PS51402]

39

526

Catalase, N-terminal

Iprscan [seg]

4

19

-

Iprscan [seg]

524

535

-

Iprscan [seg]

569

590

-

Iprscan [seg]

677

689

-

PD000510

33

522

S=1374 I=54 E=7.17275e-159

PDA7Q7T1

41

99

S=158 I=47 E=1.51713e-11

PD772939

562

672

S=154 I=38 E=5.05313e-11

PDA0C3F7

164

388

S=137 I=28 E=6.16488e-09

PDA1M4Z5

519

561

S=126 I=63 E=1.16406e-07

PD005049

591

669

S=108 I=39 E=2.04821e-05

Iprscan IPR020835 [SSF56634]

36

555

Catalase-like domain, haem-dependent

Iprscan [SSF52317]

554

698

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6cyD4JZH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

322 hits
swiss-prot

Swiss-Prot ncbi-blastp

143 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

20 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr33290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr33290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr33290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr33290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr39350549_4191448_f2_XFF4834R-XFF4834R_chr36190 XFF4834R_chr36190
XFF4834R_chr36180
XFF4834R_chr36180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36200
XFF4834R_chr36200
ID XFF4834R_chr39350549_4191448_f2_XFF4834R-XFF4834R_chr36190
AC XFF4834R_chr36190
LT XFF4834R_chr36190
OR XFF4834R_chr from 4190549 to 4191448 on strand +
DE putative manganese-containing catalase
IP Catalase, manganese; Ferritin/ribonucleotide reductase-like
CL 5.6.2 Detoxification (xenobiotic metabolism) GO:0006805
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: transition metal ion binding (GO:0046914)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100831)
MW 32184.8 Da
SQ 299 aa
 
........10........20........30........40........50
| | | | |
MFMHNKRLMYTVRVAQPNPDLATLMLEQFGGPQGELAAAMRYFTQALGED
DPGRKDLLFDIATEEISHLEIIGSIIAMLNKGPKAVLSEGMEEAMEMRNM
TQNSTSHTQQILYGGGPALVNSSGVPWTAAYVDSIGCPTADMRSNIAAEA
RAKLVYERLINVTDDPGIVDALRFLMTREVAHQKSFEKALYSIEPNFPPG
KLPGDPRFTDKYYNTSQGEGDTIGPWNAGEQWEVVADREAQAAVDGGDGS
ATVALDATQTAALDAMSERLLSNPELDRVTGADLGAGPGAGSTTGDIQR
Show or not Domain decomposition
 
XFF4834R

NP_644033.1 XAC3726-XAC3726

1

299

S=1498 I=94 E=1.97707e-174

hypothetical protein

XFF4834R

YP_365576.1 XCV3845

1

299

S=1493 I=94 E=7.97742e-174

putative manganese-containing catalase

XFF4834R

NP_639029.1 XCC3683

1

299

S=1452 I=91 E=6.9703e-169

hypothetical protein

pubmed

1

287

S=917 I=63 E=1.88988e-102

Putative catalase EC=1.11.1.6 ; Oxidoreductase Peroxidase

Pubmed 11260470

 

prodomImg

pubmed

1

190

S=331 I=39 E=2.10197e-31

Protein cotJC

Pubmed 7768848

 

prodomImg

pubmed

1

226

S=293 I=33 E=8.23488e-27

Probable manganese catalase EC=1.11.1.6 ; Calcium Metal-binding Oxidoreductase Peroxidase Stress response

Pubmed 9298659

 

prodomImg

pubmed

1

220

S=282 I=32 E=1.75679e-25

Manganese catalase EC=1.11.1.6 ; Calcium Metal-binding Oxidoreductase Peroxidase

Pubmed 8939876,11587647

 

prodomImg

pubmed

1

193

S=178 I=28 E=6.60243e-13

Manganese catalase

Pubmed 17983766

 

prodomImg

sp_Pdown

acc=Q97FE0

1

194

S=353 I=43 E=2.75866e-34

Probable manganese catalase EC=1.11.1.6 ; Calcium Metal-binding Oxidoreductase Peroxidase

sp_Pdown

acc=Q45538

1

190

S=331 I=39 E=1.43094e-31

Protein cotJC

sp_Pdown

acc=O34423

1

233

S=315 I=33 E=1.17922e-29

Uncharacterized protein yjqC

sp_Pdown

acc=P80878

1

226

S=293 I=33 E=5.606e-27

Probable manganese catalase EC=1.11.1.6 ; Calcium Metal-binding Oxidoreductase Peroxidase Stress response

sp_Pdown

acc=P60355

1

220

S=282 I=32 E=1.19596e-25

Manganese catalase EC=1.11.1.6 ; Calcium Metal-binding Oxidoreductase Peroxidase

Iprscan IPR012347 [G3DSA:1.20.1260.10]

1

198

Ferritin-related

Iprscan IPR007760 [PF05067]

1

259

Catalase, manganese

Iprscan [seg]

251

265

-

PD231137

10

241

S=577 I=51 E=1.78106e-62

PDA1Q9A1

190

247

S=133 I=50 E=1.11059e-08

PDA613A1

138

179

S=123 I=55 E=1.99016e-07

Iprscan IPR009078 [SSF47240]

1

259

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aiBVd6cG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr36190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr36190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr36190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxDAdb6/XFF4834R_chr36190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.