Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr32720radAXFF4834R_chr32720probable DNA repair protein RadA

radA XFF4834R_chr32720
XFF4834R_chr32720
XFF4834R_chr32720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3464
XFF4834R_chr_3464
ID radA
AC XFF4834R_chr32720
LT XFF4834R_chr32720
OR XFF4834R_chr from 3769121 to 3770512 on strand -
DE probable DNA repair protein RadA
IP DNA repair protein RadA
CL 5.6.1 Radiation GO:0009314
EC
GO InterPro
Biological Process: DNA repair (GO:0006281)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: damaged DNA binding (GO:0003684)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 48656.4 Da
SQ 463 aa
 
........10........20........30........40........50
| | | | |
MAKAKAAYVCGECGAEYTKWQGQCTECGVWNTLSEIVLESATPGGKTSPA
ASRRSGWAGKAEAPKITALKDVQQSEQARVSTGIGEFDRVLGGGLVEGAV
VLIGGDPGIGKSTLLLQALASMASTLPVLYVTGEESLAQVAGRAVRLDLP
LEGLNALAETGIENILQHASVARPKLIVADSVQTLWTESLTAAPGSVSQV
RESAARLVRYAKETGTAVFLVGHVTKEGGIAGPRVLEHMVDAVLYFEGES
GSRFRLLRAFKNRFGAVNELGVFAMGEKGLKEVSNPSAIFLSGGSTQQPG
SCVMVTREGTRPLMVEVQALVDASPLSNPRRVAVGLEQNRLAMLLAVLHR
HGGIVVGDQDVFVNVVGGIRVQETAADLPVLLAVLSSLRDRPLSEKTIAF
GEVGLSGEIRPVPNGEDRLKEAATHGFKRAIVPRANAPKTTSIKGMEIIA
VERLSQALEAAAD
XFF4834R

NP_641598.1 lcl|radA-XAC1263

1

463

S=2212 I=93 E=0

DNA repair protein RadA

XFF4834R

YP_363043.1 lcl|radA-XCV1312

1

463

S=2198 I=93 E=0

DNA repair protein RadA

XFF4834R

NP_636538.2 lcl|radA-XCC1164

1

463

S=2171 I=91 E=0

DNA repair protein RadA

XFF4834R

lcl|radA-XALc_0935

1

462

S=1993 I=85 E=0

probable dna repair protein rada homolog (dna repair protein sms homolog)

pubmed

1

463

S=1289 I=56 E=2.96337e-147

DNA repair protein radA ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

Pubmed 1327967,8759876

 

prodomImg

pubmed

1

463

S=1280 I=55 E=3.09282e-146

DNA repair protein radA ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

Pubmed 2198247

 

prodomImg

pubmed

1

461

S=1009 I=44 E=2.21748e-113

DNA repair protein radA homolog ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

Pubmed 7584024

 

prodomImg

pubmed

1

460

S=931 I=44 E=7.01779e-104

DNA repair protein radA ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

Pubmed 12446909

 

prodomImg

pubmed

1

461

S=913 I=42 E=1.10249e-101

DNA repair protein radA homolog ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

Pubmed 8885268

 

prodomImg

sp_Pdown

sp|P96963|RADA_PSEAE

1

460

S=1367 I=60 E=6.53532e-157

DNA repair protein radA homolog ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

sp_Pdown

sp|P24554|RADA_ECOLI

1

463

S=1289 I=56 E=2.01488e-147

DNA repair protein radA ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

sp_Pdown

sp|P24517|RADA_SALTY

1

463

S=1280 I=55 E=2.1029e-146

DNA repair protein radA ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

sp_Pdown

sp|P45266|RADA_HAEIN

1

458

S=1218 I=54 E=7.2736e-139

DNA repair protein radA homolog ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

sp_Pdown

sp|P37572|RADA_BACSU

1

461

S=1009 I=44 E=1.50773e-113

DNA repair protein radA homolog ; ATP-binding damage DNA-binding Metal-binding Nucleotide-binding Zinc Zinc-finger

Iprscan IPR004504 [PR01874]

10

34

DNA repair protein RadA

Iprscan IPR004504 [PR01874]

89

117

DNA repair protein RadA

Iprscan IPR004504 [PR01874]

130

147

DNA repair protein RadA

Iprscan IPR004504 [PR01874]

180

204

DNA repair protein RadA

Iprscan IPR004504 [PR01874]

219

247

DNA repair protein RadA

Iprscan IPR004504 [PR01874]

254

280

DNA repair protein RadA

Iprscan IPR004504 [PR01874]

328

351

DNA repair protein RadA

Iprscan [G3DSA:3.40.50.300]

60

281

-

Iprscan [PTHR12896]

77

116

-

Iprscan IPR014774 [PF06745]

80

155

Circadian clock protein KaiC/DNA repair protein RadA

Iprscan [PF05362]

372

461

-

Iprscan IPR003593 [SM00382]

97

250

ATPase, AAA+ type, core

Iprscan IPR004504 [TIGR00416]

1

458

DNA repair protein RadA

Iprscan [seg]

90

105

-

Iprscan [seg]

355

368

-

PD007508

173

291

S=434 I=67 E=4.42939e-45

PD380995

384

458

S=244 I=64 E=5.03933e-22

PD583052

283

354

S=220 I=65 E=3.64069e-19

PD699140

33

73

S=197 I=98 E=2.56233e-16

PD838850

1

32

S=135 I=66 E=7.3799e-09

Iprscan [SSF52540]

61

285

-

Iprscan IPR020568 [SSF54211]

298

461

Ribosomal protein S5 domain 2-type fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FpjH0kte)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSGL7AJ/XFF4834R_chr32720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSGL7AJ/XFF4834R_chr32720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSGL7AJ/XFF4834R_chr32720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSGL7AJ/XFF4834R_chr32720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.