Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr00090ExbB1XFF4834R_chr00090biopolymer transport ExbB protein
  2. XFF4834R_chr00100exbD1XFF4834R_chr00100biopolymer transport ExbD protein
  3. XFF4834R_chr04910bfr1XFF4834R_chr04910probable bacterioferritin
  4. XFF4834R_chr30590bfr2XFF4834R_chr30590probable bacterioferritin
  5. XFF4834R_chr33960XFF4834R_chr36790902_3917462_f3_XFF4834R-XFF4834R_chr33960XFF4834R_chr33960putative bacterioferritin

ExbB1 XFF4834R_chr00090
XFF4834R_chr00080
XFF4834R_chr00080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00100
XFF4834R_chr00100
ID ExbB1
AC XFF4834R_chr00090
LT XFF4834R_chr00090
OR XFF4834R_chr from 11680 to 12441 on strand +
DE biopolymer transport ExbB protein
IP MotA/TolQ/ExbB proton channel
CL 5.5.7 Fe aquisition GO:0006826
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN test sebastien
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101121)
MW 26696.1 Da
SQ 253 aa
 
........10........20........30........40........50
| | | | |
MLQEFFIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVVLITLI
AMSAASWYWTVINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPAS
EPFSKIALDAAQAAAHHQRAEGSTGGLGESLSRSEFVDRALRQAVTREST
KLQSGMTLLATVGATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPV
GEALIMTAIGLFVAIPAVFAFNFFSKVNSSVIAKFDTFAHDLHDFFATGS
RVR
XFF4834R

XFF4834R_chr14840 lcl|tolQ-XFF4834R_chr14840

138

241

S=228 I=48 E=2.93482e-21

membrane spanning protein in TolA-TolQ-TolR complex

XFF4834R

XFF4834R_chr21910 lcl|XFF4834R_chr23880718_2538347_f3_XFF4834R-XFF4834R_chr21910

151

239

S=138 I=31 E=2.08788e-10

XFF4834R

YP_361740.1 lcl|exbB1-XCV0009

1

253

S=1075 I=85 E=2.26702e-123

biopolymer transport ExbB protein

XFF4834R

NP_640365.1 lcl|exbB-XAC0009

1

253

S=1075 I=85 E=2.26702e-123

biopolymer transport ExbB protein

XFF4834R

NP_635404.1 lcl|exbB-XCC0009

1

253

S=1069 I=85 E=1.17789e-122

biopolymer transport ExbB protein

XFF4834R

lcl|exbB-XALc_0009

1

253

S=1031 I=81 E=5.16844e-118

probable biopolymer transport protein

XFF4834R

NP_638368.1 lcl|tolQ-XCC3021

138

241

S=229 I=48 E=8.47402e-21

TolQ protein

XFF4834R

YP_365006.1 lcl|tolQ-XCV3275

138

241

S=228 I=48 E=1.06301e-20

biopolymer transport TolQ protein

XFF4834R

NP_643453.1 lcl|tolQ-XAC3145

138

241

S=228 I=48 E=1.09118e-20

TolQ protein

XFF4834R

lcl|tolQ-XALc_2426

139

241

S=207 I=44 E=4.20805e-18

probable biopolymer transport tolq transmembrane protein

XFF4834R

YP_363983.1 lcl|exbB2-XCV2252

151

239

S=138 I=31 E=8.92494e-10

biopolymer transport ExbB protein

XFF4834R

NP_642406.1 lcl|exbB-XAC2085

151

239

S=137 I=31 E=1.29845e-09

biopolymer transport protein

pubmed

1

253

S=1069 I=85 E=4.29297e-121

ExbB ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

253

S=1069 I=85 E=4.29297e-121

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

23

252

S=408 I=38 E=5.6418e-41

MotA/TolQ/ExbB proton channel family protein ExbB protein ; transport Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

23

252

S=403 I=38 E=2.37789e-40

ExbB ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

37

250

S=384 I=42 E=4.48622e-38

ExbB ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

37

249

S=355 I=38 E=1.74376e-34

ExbB ; Protein transport Transmembrane

Pubmed 16457898,18671744

 

prodomImg

pubmed

45

243

S=328 I=37 E=3.43357e-31

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

pubmed

45

243

S=320 I=36 E=2.78296e-30

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

137

245

S=300 I=50 E=7.06217e-28

Transport protein ExbB ExbB ; Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

136

242

S=280 I=48 E=2.15222e-25

TolQ protein ; transport Transmembrane

Pubmed 10678921

 

prodomImg

Iprscan IPR002898 [PF01618]

100

240

MotA/TolQ/ExbB proton channel

Iprscan [seg]

8

19

-

Iprscan [seg]

110

120

-

Iprscan [seg]

121

135

-

Iprscan [tmhmm]

39

61

-

Iprscan [tmhmm]

161

183

-

Iprscan [tmhmm]

203

225

-

PD003317

146

253

S=258 I=48 E=7.69901e-24

PDA1K115

224

253

S=149 I=93 E=1.50338e-10

PD873528

32

107

S=134 I=37 E=9.13085e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YIHV2HdF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

48 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
exbD1 XFF4834R_chr00100
XFF4834R_chr00090
XFF4834R_chr00090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00110
XFF4834R_chr00110
ID exbD1
AC XFF4834R_chr00100
LT XFF4834R_chr00100
OR XFF4834R_chr from 12488 to 12910 on strand +
DE biopolymer transport ExbD protein
IP Biopolymer transport protein ExbD/TolR
CL 5.5.7 Fe aquisition GO:0006826
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101121)
MW 15184.5 Da
SQ 140 aa
 
........10........20........30........40........50
| | | | |
MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVELPEAN
LIQKEDAEKRAAPITLAVKEDGSLYWNDEPISKEALESRLSTAAQQTPQP
PLNLRGDRTTKMRTINEITKIAQGQGMLDVGFVATKVKGQ
XFF4834R

XFF4834R_chr00110 lcl|XFF4834R_chr00100914_0013327_f2_XFF4834R-XFF4834R_chr00110

1

133

S=251 I=39 E=2.26201e-24

XFF4834R

XFF4834R_chr00120 lcl|XFF4834R_chr00110830_0014237_f3_XFF4834R-XFF4834R_chr00120

1

133

S=245 I=41 E=1.14495e-23

XFF4834R

XFF4834R_chr14850 lcl|XFF4834R_chr15930563_1707012_f1_XFF4834R-XFF4834R_chr14850

13

74

S=120 I=45 E=1.60253e-08

XFF4834R

XFF4834R_chr21920 lcl|XFF4834R_chr23890351_2538815_f3_XFF4834R-XFF4834R_chr21920

15

95

S=104 I=32 E=1.25331e-06

XFF4834R

YP_361741.1 lcl|exbD1-XCV0010

1

140

S=729 I=100 E=9.56865e-82

biopolymer transport ExbD protein

XFF4834R

NP_640366.1 lcl|exbD1-XAC0010

1

140

S=729 I=100 E=9.56865e-82

biopolymer transport ExbD1 protein

XFF4834R

NP_635405.1 lcl|exbD1-XCC0010

1

140

S=723 I=99 E=5.01518e-81

biopolymer transport ExbD1 protein

XFF4834R

lcl|exbD1-XALc_0010

1

140

S=639 I=88 E=6.98769e-71

probable biopolymer transport exbd transmembrane protein

XFF4834R

lcl|exbD2-XALc_0011

1

133

S=279 I=43 E=3.0732e-27

probable biopolymer transport exbd. transmembrane protein

XFF4834R

YP_361742.1 lcl|exbD2-XCV0011

1

133

S=251 I=39 E=8.06872e-24

biopolymer transport ExbD protein

XFF4834R

NP_640367.1 lcl|exbD2-XAC0011

1

133

S=251 I=39 E=8.06872e-24

biopolymer transport ExbD2 protein

XFF4834R

NP_635406.1 lcl|exbD2-XCC0011

1

133

S=246 I=39 E=3.06295e-23

biopolymer transport ExbD2 protein

XFF4834R

YP_361743.1 lcl|exbD3-XCV0012

1

133

S=245 I=41 E=4.01348e-23

biopolymer transport ExbD protein

XFF4834R

lcl|tolR-XALc_2425

13

134

S=151 I=32 E=9.02534e-12

probable biopolymer transport tolr protein.

pubmed

1

140

S=723 I=99 E=1.51528e-79

ExbD1 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

140

S=723 I=99 E=1.51528e-79

Biopolymer transport protein exbD1 ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

1

133

S=289 I=45 E=5.22696e-27

ExbD ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

1

135

S=262 I=36 E=1.09399e-23

Biopolymer transport protein ExbD/TolR ExbD protein ; Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

1

135

S=260 I=36 E=1.72152e-23

ExbD ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

1

133

S=246 I=39 E=9.25434e-22

Biopolymer transport protein exbD2 ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

1

133

S=241 I=38 E=3.10935e-21

ExbD2 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

140

S=238 I=40 E=9.16635e-21

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

1

133

S=232 I=40 E=4.14249e-20

ExbD1 ; Protein transport Transmembrane

Pubmed 16457898,18671744

 

prodomImg

pubmed

1

140

S=232 I=39 E=4.76262e-20

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

Iprscan IPR003400 [PF02472]

8

137

Biopolymer transport protein ExbD/TolR

Iprscan [tmhmm]

15

37

-

PDA1K308

85

140

S=229 I=77 E=2.87329e-20

PD007356

24

84

S=141 I=47 E=1.19053e-09

PD689034

14

81

S=125 I=33 E=1.22004e-07

PDA1H5U6

1

25

S=118 I=92 E=8.45237e-07

PD694913

15

82

S=115 I=37 E=1.74284e-06

PDA379Q2

12

69

S=108 I=42 E=1.29466e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OV7JbO8U)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

34 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr00100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
bfr1 XFF4834R_chr04910
XFF4834R_chr_0540
XFF4834R_chr_0540
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04920
XFF4834R_chr04920
ID bfr1
AC XFF4834R_chr04910
LT XFF4834R_chr04910
OR XFF4834R_chr from 554391 to 554861 on strand +
DE probable bacterioferritin
IP Ferritin/Dps protein; Ferritin/ribonucleotide reductase-like
CL 5.5.7 Fe aquisition GO:0006826
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: iron ion transport (GO:0006826)
Biological Process: cellular iron ion homeostasis (GO:0006879)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: transition metal ion binding (GO:0046914)
Molecular Function: ferric iron binding (GO:0008199)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: acur
CC STATUS: curated by lgagnevin (20100729)
MW 18214.7 Da
SQ 156 aa
 
........10........20........30........40........50
| | | | |
MKGDTKVIEYLNKVLYNELTAINQYFLHAKMLKNWGLKELAEHEYKESID
EMKHADKLSDRILFLEGLPNFQALGKLRIGENPTEMFRCDLTLEREAVVV
LREAVAYAETVKDYVSRQLLVDILESEEEHIDWLETQLDLVARIGEPNYL
LTKLDD
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr30590 lcl|XFF4834R_chr33250207_3516692_r2_XFF4834R-XFF4834R_chr30590

1

155

S=231 I=38 E=6.94864e-22

XFF4834R

YP_362258.1 lcl|bfr-XCV0527

1

156

S=713 I=89 E=7.87472e-80

bacterioferritin

XFF4834R

NP_640846.1 lcl|bfr-XAC0493

1

156

S=708 I=88 E=3.31901e-79

bacterioferritin

XFF4834R

NP_635874.1 lcl|bfr-XCC0482

1

156

S=706 I=88 E=5.90089e-79

bacterioferritin

XFF4834R

lcl|bfr-XALc_0296

1

156

S=657 I=80 E=5.52378e-73

probable bacterioferritin protein

XFF4834R

NP_636767.1 lcl|brf-XCC1393

1

155

S=232 I=38 E=1.60186e-21

bacterioferritin

XFF4834R

YP_363226.1 lcl|brf-XCV1495

1

155

S=230 I=38 E=3.13463e-21

bacterioferritin

XFF4834R

NP_641773.1 lcl|brf-XAC1438

1

155

S=230 I=38 E=3.13463e-21

bacterioferritin

XFF4834R

lcl|bfr-XALc_2013

1

155

S=210 I=37 E=7.35426e-19

putative bacterioferritine (bfr) protein

pubmed

1

156

S=484 I=62 E=2.03471e-50

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 1549605,1904771

 

prodomImg

pubmed

1

154

S=466 I=60 E=2.66169e-48

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 2661540

 

prodomImg

pubmed

1

150

S=416 I=57 E=2.79062e-42

Bacterioferritin subunit 2 ; Heme Iron storage Metal-binding

Pubmed 9409768

 

prodomImg

pubmed

2

154

S=384 I=50 E=2.31598e-38

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 12897839

 

prodomImg

pubmed

1

156

S=374 I=49 E=3.45581e-37

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 16980464

 

prodomImg

sp_Pdown

sp|P22759|BFR_AZOVI

1

156

S=484 I=62 E=1.37891e-50

Bacterioferritin ; Heme Iron storage Metal-binding

sp_Pdown

sp|P0ABD3|BFR_ECOLI

1

154

S=466 I=60 E=1.80382e-48

Bacterioferritin ; Heme Iron storage Metal-binding

sp_Pdown

sp|P0ABD4|BFR_ECOL6

1

154

S=466 I=60 E=1.80382e-48

Bacterioferritin ; Heme Iron storage Metal-binding

sp_Pdown

sp|O68935|BFR_SERMA

1

149

S=464 I=60 E=2.96499e-48

Bacterioferritin ; Heme Iron storage Metal-binding

sp_Pdown

sp|O68926|BFR_SALTY

1

154

S=461 I=58 E=7.02891e-48

Bacterioferritin ; Heme Iron storage Metal-binding

Iprscan IPR002024 [PR00601]

3

22

Bacterioferritin

Iprscan IPR002024 [PR00601]

23

43

Bacterioferritin

Iprscan IPR002024 [PR00601]

44

64

Bacterioferritin

Iprscan IPR002024 [PR00601]

65

85

Bacterioferritin

Iprscan IPR002024 [PR00601]

86

106

Bacterioferritin

Iprscan IPR002024 [PR00601]

107

127

Bacterioferritin

Iprscan IPR002024 [PR00601]

128

149

Bacterioferritin

Iprscan IPR012347 [G3DSA:1.20.1260.10]

1

156

Ferritin-related

Iprscan IPR002024 [PIRSF002560]

1

155

Bacterioferritin

Iprscan IPR008331 [PF00210]

8

143

Ferritin/Dps protein

Iprscan IPR002024 [TIGR00754]

1

156

Bacterioferritin

Iprscan IPR002024 [PS00549]

1

19

Bacterioferritin

Iprscan IPR009040 [PS50905]

1

145

Ferritin-like

Iprscan [seg]

93

109

-

PD002269

1

51

S=207 I=80 E=1.19614e-17

PDA33752

26

82

S=159 I=49 E=7.83167e-12

PDA00179

4

131

S=145 I=28 E=3.66187e-10

PDA4N5V7

49

156

S=131 I=32 E=1.86817e-08

PDA7T478

76

156

S=124 I=44 E=1.58165e-07

PD857578

6

69

S=111 I=39 E=4.82415e-06

PDA7G2L6

51

81

S=108 I=65 E=1.45985e-05

PDA1F8P6

50

74

S=104 I=84 E=3.43071e-05

PDA7G2M4

44

82

S=102 I=49 E=6.54012e-05

Iprscan IPR009078 [SSF47240]

1

156

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one O3QXsKnV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

32 hits
swiss-prot

Swiss-Prot ncbi-blastp

27 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr04910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr04910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr04910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr04910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
bfr2 XFF4834R_chr30590
XFF4834R_chr_3231
XFF4834R_chr_3231
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3233
XFF4834R_chr_3233
ID bfr2
AC XFF4834R_chr30590
LT XFF4834R_chr30590
OR XFF4834R_chr from 3516207 to 3516692 on strand -
DE probable bacterioferritin
IP Ferritin/Dps protein; Ferritin/ribonucleotide reductase-like
CL 5.5.7 Fe aquisition GO:0006826
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: iron ion transport (GO:0006826)
Biological Process: cellular iron ion homeostasis (GO:0006879)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: transition metal ion binding (GO:0046914)
Molecular Function: ferric iron binding (GO:0008199)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110713)
MW 18764.2 Da
SQ 161 aa
 
........10........20........30........40........50
| | | | |
MKGHPEVVDYLKQLLRGELAARDQYFLHSRRYEDQGLMALYERINHEMEE
ETEHADALLRRILFLEGDPDMRPAQFTPGKTVVEMLERDLVVEYEVRAAL
AAGMKLCEEHGDYVSRDVLLKQLQDTEEDHAWWLEQQLGLIKRIGLELYQ
TSKIDKGHIAG
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr04910 lcl|bfr-XFF4834R_chr04910

1

155

S=258 I=41 E=4.00146e-25

bacterioferritin, iron storage and detoxification protein

XFF4834R

YP_363226.1 lcl|brf-XCV1495

1

161

S=831 I=99 E=5.01251e-94

bacterioferritin

XFF4834R

NP_641773.1 lcl|brf-XAC1438

1

161

S=831 I=99 E=5.01251e-94

bacterioferritin

XFF4834R

NP_636767.1 lcl|brf-XCC1393

1

161

S=818 I=96 E=1.78864e-92

bacterioferritin

XFF4834R

lcl|bfr-XALc_2013

1

155

S=700 I=86 E=3.37013e-78

putative bacterioferritine (bfr) protein

XFF4834R

NP_640846.1 lcl|bfr-XAC0493

1

155

S=260 I=41 E=6.42035e-25

bacterioferritin

XFF4834R

lcl|bfr-XALc_0296

1

155

S=258 I=42 E=1.12175e-24

probable bacterioferritin protein

XFF4834R

YP_362258.1 lcl|bfr-XCV0527

1

155

S=258 I=41 E=1.43191e-24

bacterioferritin

XFF4834R

NP_635874.1 lcl|bfr-XCC0482

1

155

S=254 I=40 E=3.83523e-24

bacterioferritin

pubmed

1

154

S=576 I=69 E=1.46415e-61

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 15345421

 

prodomImg

pubmed

1

154

S=552 I=68 E=1.19511e-58

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 11728709

 

prodomImg

pubmed

1

154

S=536 I=67 E=8.56633e-57

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 9358059

 

prodomImg

pubmed

1

154

S=444 I=61 E=1.2566e-45

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 1536655

 

prodomImg

pubmed

1

152

S=330 I=50 E=7.55597e-32

Bacterioferritin subunit 1 ; Heme Iron storage Metal-binding

Pubmed 9409768

 

prodomImg

sp_Pdown

sp|Q9HWF9|BFR_PSEAE

1

154

S=564 I=71 E=2.39272e-60

Bacterioferritin ; Heme Iron storage Metal-binding

sp_Pdown

sp|P77930|BFR_PSEPU

1

154

S=536 I=67 E=5.91018e-57

Bacterioferritin ; Heme Iron storage Metal-binding

sp_Pdown

sp|P56998|BFRA_NEIMA

1

154

S=451 I=59 E=1.25141e-46

Bacterioferritin A ; Heme Iron storage Metal-binding

sp_Pdown

sp|P0A0R1|BFRA_NEIMB

1

154

S=448 I=58 E=2.67194e-46

Bacterioferritin A ; Heme Iron storage Metal-binding

sp_Pdown

sp|P0A0R2|BFRA_NEIGO

1

154

S=448 I=58 E=2.67194e-46

Bacterioferritin A ; Heme Iron storage Metal-binding

Iprscan [coil]

41

62

-

Iprscan IPR002024 [PR00601]

3

22

Bacterioferritin

Iprscan IPR002024 [PR00601]

23

43

Bacterioferritin

Iprscan IPR002024 [PR00601]

44

64

Bacterioferritin

Iprscan IPR002024 [PR00601]

85

105

Bacterioferritin

Iprscan IPR002024 [PR00601]

106

126

Bacterioferritin

Iprscan IPR002024 [PR00601]

128

149

Bacterioferritin

Iprscan IPR012347 [G3DSA:1.20.1260.10]

1

161

Ferritin-related

Iprscan IPR002024 [PIRSF002560]

1

158

Bacterioferritin

Iprscan IPR008331 [PF00210]

9

144

Ferritin/Dps protein

Iprscan IPR002024 [TIGR00754]

1

157

Bacterioferritin

Iprscan IPR002024 [PS00549]

1

19

Bacterioferritin

Iprscan IPR009040 [PS50905]

1

145

Ferritin-like

PDA4N5V7

50

152

S=192 I=47 E=8.61533e-16

PDA1P2L7

48

78

S=151 I=94 E=8.0014e-11

PD002269

1

47

S=130 I=55 E=2.80348e-08

PDA33748

48

72

S=109 I=84 E=9.90867e-06

PDA7G2K4

48

72

S=104 I=84 E=3.96342e-05

Iprscan IPR009078 [SSF47240]

1

156

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fTrQI1vF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr30590.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr30590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr30590.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr30590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr36790902_3917462_f3_XFF4834R-XFF4834R_chr33960 XFF4834R_chr33960
XFF4834R_chr33960
XFF4834R_chr33960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3605
XFF4834R_chr_3605
ID XFF4834R_chr36790902_3917462_f3_XFF4834R-XFF4834R_chr33960
AC XFF4834R_chr33960
LT XFF4834R_chr33960
OR XFF4834R_chr from 3916902 to 3917462 on strand +
DE putative bacterioferritin
IP Ferritin/Dps protein; Ferritin/ribonucleotide reductase-like
CL 5.5.7 Fe aquisition GO:0006826
EC
GO InterPro
Biological Process: cellular iron ion homeostasis (GO:0006879)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: ferric iron binding (GO:0008199)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: transition metal ion binding (GO:0046914)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100830)
MW 21130.3 Da
SQ 186 aa
 
........10........20........30........40........50
| | | | |
MSDQPATNTPAGITDTATLRARARQSIEDGAITESYHADREKVIELLNTA
LATEYVCTLRYYRHYFMAKGMLADAVKGEFLEHAQQEQEHAHKLAERIVQ
LGGEPDLNPDTLTKRSHAEYKEGTDLRDMVKENLIAERIAIDSYREMIDF
IGDKDTTTKRILESILAQEEEHADEFADMLEGWIGE
XFF4834R

XFF4834R_chr04910 bfr-XFF4834R_chr04910

42

174

S=119 I=32 E=3.06699e-08

bacterioferritin, iron storage and detoxification protein

XFF4834R

NP_641485.1 XAC1149-XAC1149

1

186

S=979 I=99 E=7.20908e-112

bacterioferritin

XFF4834R

YP_362900.1 XCV1169

1

186

S=976 I=99 E=1.81656e-111

putative bacterioferritin

XFF4834R

NP_636420.1 XCC1045

1

186

S=937 I=97 E=7.63083e-107

bacterioferritin

XFF4834R

NP_640846.1 bfr-XAC0493

42

174

S=125 I=33 E=2.24199e-08

bacterioferritin

XFF4834R

YP_362258.1 bfr-XCV0527

42

174

S=119 I=32 E=1.1152e-07

bacterioferritin

XFF4834R

NP_635874.1 bfr-XCC0482

42

174

S=115 I=31 E=3.77974e-07

bacterioferritin

XFF4834R

XALc_0296 bfr-XALc_0296

42

174

S=111 I=30 E=1.02123e-06

probable bacterioferritin protein

pubmed

42

180

S=135 I=32 E=5.42337e-08

DNA protection during starvation protein EC=1.16.-.- ; Cytoplasm condensation DNA-binding Heme Iron storage Metal-binding Oxidoreductase

Pubmed 7673237,7794101

 

prodomImg

pubmed

42

180

S=135 I=32 E=5.42337e-08

Nutrient stress-induced DNA-binding protein ; Heme Iron Metal-binding

Pubmed 10411274

 

prodomImg

pubmed

41

182

S=130 I=29 E=2.20748e-07

Ferritin (Non-heme iron-containing protein)

Pubmed 11772643

 

prodomImg

pubmed

42

174

S=129 I=31 E=2.3464e-07

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 8674981,11752777

 

prodomImg

pubmed

41

176

S=129 I=31 E=2.91786e-07

Ferritin and Dps Nutrient-stress induced DNA binding protein

Pubmed 16597998

 

prodomImg

sp_Pdown

acc=Q55024

42

180

S=135 I=32 E=3.71886e-08

DNA protection during starvation protein EC=1.16.-.- ; Cytoplasm condensation DNA-binding Heme Iron storage Metal-binding Oxidoreductase

sp_Pdown

acc=Q9R6T3

42

180

S=135 I=32 E=3.71886e-08

Nutrient stress-induced DNA-binding protein ; Heme Iron Metal-binding

sp_Pdown

acc=Q59738

42

174

S=129 I=31 E=1.60895e-07

Bacterioferritin ; Heme Iron storage Metal-binding

sp_Pdown

acc=Q8U1L3

39

182

S=128 I=34 E=2.24094e-07

DNA protection during starvation protein EC=1.16.-.- ; Cytoplasm DNA-binding Iron storage Metal-binding Oxidoreductase

sp_Pdown

acc=Q8YQL3

43

180

S=118 I=31 E=4.05088e-06

Nutrient stress-induced DNA-binding protein ; Heme Iron Metal-binding

Iprscan IPR012347 [G3DSA:1.20.1260.10]

32

180

Ferritin-related

Iprscan IPR014490 [PIRSF018063]

13

186

Uncharacterised conserved protein UCP018063, ferritin fold

Iprscan IPR008331 [PF00210]

44

181

Ferritin/Dps protein

Iprscan IPR009040 [PS50905]

37

186

Ferritin-like

PD857578

39

105

S=224 I=63 E=1.04166e-19

PDA1V084

1

38

S=187 I=97 E=3.03399e-15

PD647233

39

180

S=138 I=32 E=2.60296e-09

PDA7I287

91

120

S=127 I=77 E=6.7272e-08

PD867876

39

181

S=110 I=32 E=7.07666e-06

PD149803

38

105

S=109 I=37 E=8.87723e-06

Iprscan IPR009078 [SSF47240]

29

181

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RiUOAVEW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr33960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr33960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr33960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnd7WxH/XFF4834R_chr33960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.