Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr24370sspBXFF4834R_chr24370putative ClpXP protease specificity-enhancing factor
  2. XFF4834R_chr41040rspAXFF4834R_chr41040probable starvation-sensing protein

sspB XFF4834R_chr24370
XFF4834R_chr24360
XFF4834R_chr24360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24380
XFF4834R_chr24380
ID sspB
AC XFF4834R_chr24370
LT XFF4834R_chr24370
OR XFF4834R_chr from 2812350 to 2812790 on strand -
DE putative ClpXP protease specificity-enhancing factor
IP Stringent starvation protein B
CL 5.5.3 Starvation response GO:0042594
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100929)
MW 15419.5 Da
SQ 146 aa
 
........10........20........30........40........50
| | | | |
MSEDFPRMTSHRPYLLRALVEWINDNGMTPHVLVDAGLPGVQVPASAVKD
GRVVLNIAERAVVGLQVDNESVSFTARFGGVSHPVMVPMAAVLAVYARET
GQGMALPDDIPGTSSEPPDPGTPPPSAPTPDEPPSGGKRPHLRVVK
Show or not Domain decomposition
 
XFF4834R

YP_364361.1 lcl|sspB-XCV2630

1

146

S=512 I=73 E=1.99028e-55

ClpXP protease specificity-enhancing factor

XFF4834R

NP_642768.1 lcl|sspB-XAC2453

1

146

S=510 I=73 E=3.21493e-55

ClpXP protease specificity-enhancing factor

XFF4834R

NP_637674.1 lcl|sspB-XCC2320

1

146

S=485 I=69 E=3.23496e-52

ClpXP protease specificity-enhancing factor

XFF4834R

lcl|sspB-XALc_1268

1

146

S=434 I=64 E=5.15424e-46

probable stringent starvation protein b

pubmed

4

103

S=253 I=48 E=1.54594e-22

Stringent starvation protein B ; Stress response

Pubmed 1721886

 

prodomImg

pubmed

9

72

S=152 I=44 E=2.20736e-10

RegG protein

Pubmed 9765808

 

prodomImg

pubmed

8

104

S=152 I=33 E=2.5378e-10

Macrophage growth locus B

Pubmed 9701818

 

prodomImg

sp_Pdown

sp|P0AFZ3|SSPB_ECOLI

4

103

S=253 I=48 E=1.08435e-22

Stringent starvation protein B ; Stress response

sp_Pdown

sp|P0AFZ4|SSPB_ECO57

4

103

S=253 I=48 E=1.08435e-22

Stringent starvation protein B ; Stress response

sp_Pdown

sp|Q83Q08|SSPB_SHIFL

4

103

S=243 I=47 E=1.56258e-21

Stringent starvation protein B

sp_Pdown

sp|P45206|SSPB_HAEIN

7

110

S=216 I=42 E=3.32797e-18

Stringent starvation protein B homolog

Iprscan IPR007481 [PIRSF005276]

3

146

Stringent starvation protein B

Iprscan IPR007481 [PF04386]

8

146

Stringent starvation protein B

Iprscan [seg]

84

97

-

Iprscan [seg]

111

136

-

PD021091

12

106

S=286 I=59 E=3.88302e-27

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5Dgzo5fj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr24370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr24370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr24370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr24370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rspA XFF4834R_chr41040
XFF4834R_chr41030
XFF4834R_chr41030
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41050
XFF4834R_chr41050
ID rspA
AC XFF4834R_chr41040
LT XFF4834R_chr41040
OR XFF4834R_chr from 4764733 to 4765992 on strand +
DE probable starvation-sensing protein
IP O-succinylbenzoic acid (OSB) synthetase, low GC Gram-positive bacteria/archaea; Mandelate racemase/muconate lactonizing enzyme, conserved site
CL 5.5.3 Starvation response GO:0042594
EC
GO InterPro
Biological Process: cellular amino acid catabolic process (GO:0009063)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN Mandelate racemase EC:5.1.2.2 (MR) and muconate lactonizing enzyme EC:5.5.1.1 (MLE) are two bacterial enzymes involved in aromatic acid catabolism. They catalyse mechanistically distinct reactions yet they are related at the level of their primary, quaternary (homooctamer) and tertiary structures [1, 2]. A number of other proteins also seem to be evolutionary related to these two enzymes. These include, various plasmid-encoded chloromuconate cycloisomerases EC:5.5.1.7, Escherichia coli protein rspA [3], E. coli bifunctional DGOA protein, E. coli hypothetical proteins ycjG, yfaW and yidU and a hypothetical protein from Streptomyces ambofaciens [4].
CC COG: [MR] Cell wall/membrane/envelope biogenesis;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100824)
MW 46729.6 Da
SQ 419 aa
 
........10........20........30........40........50
| | | | |
MSQTSDSPAPLQGSARDREIVEARVIVTCPGRNFVTLKIRTRSGITGVGD
ATLNGRELAVAAYLQEHLVPNLIGRDAGRIEDIWQFFYRGAYWRRGPVTM
SAIAAVDVALWDILGKMAGMPLYQLLGGRSREGALVYGHANGRDIAETSD
EVGRFREMGFIAIRAQCGVPGIKKTYGISVGGKPYEPAESELPTETVWST
PRYLGVVPRLFEQLRADHGDAIELLHDAHHRLTPIEAARLGRDLEPYRLF
WLEDATPAENQRAFEIIRQHTVTPLAVGEVFNSIWDCKHLIEQQLIDYIR
TTIVHAGGLTHVRRLADFAALHQVRTGFHGATDLSPVCMGAALHFDTWVP
NFGIQEYMFHSDEANAVFPHDYQFRDGRLHCGETPGHGVDIDEALAAKYP
YVPKQLPIARLEDGAMWDW
XFF4834R

XFF4834R_chr27470 lcl|dgoD-XFF4834R_chr27470

34

160

S=245 I=40 E=4.84164e-23

galactonate dehydratase

XFF4834R

XFF4834R_chr27470 lcl|dgoD-XFF4834R_chr27470

213

419

S=200 I=28 E=1.1631e-17

galactonate dehydratase

XFF4834R

YP_366066.1 lcl|rspA-XCV4335

1

419

S=2211 I=99 E=0

starvation sensing protein

XFF4834R

NP_644528.1 lcl|rspA-XAC4229

1

419

S=2209 I=99 E=0

starvation sensing protein

XFF4834R

NP_639443.1 lcl|rspA-XCC4104

1

419

S=2182 I=97 E=0

starvation sensing protein

XFF4834R

lcl|rspA-XALc_0060

1

419

S=2040 I=89 E=0

probable starvation-sensing protein

XFF4834R

lcl|dgoD-XALc_1189

34

419

S=375 I=30 E=2.85247e-38

probable galactonate dehydratase protein

XFF4834R

YP_363527.1 lcl|dgoD-XCV1796

34

160

S=246 I=40 E=1.52884e-22

galactonate dehydratase

XFF4834R

YP_363527.1 lcl|dgoD-XCV1796

213

419

S=201 I=28 E=3.83636e-17

galactonate dehydratase

XFF4834R

NP_642093.1 lcl|dgoA-XAC1765

34

160

S=245 I=40 E=1.93463e-22

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase

XFF4834R

NP_642093.1 lcl|dgoA-XAC1765

213

419

S=201 I=28 E=4.25948e-17

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase

XFF4834R

NP_637113.1 lcl|dgoA-XCC1746

34

160

S=245 I=40 E=1.9859e-22

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase

XFF4834R

NP_637113.1 lcl|dgoA-XCC1746

213

419

S=197 I=28 E=1.15085e-16

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase

pubmed

19

419

S=1499 I=67 E=9.02348e-173

Starvation-sensing protein rspA

Pubmed 7545940

 

prodomImg

pubmed

20

419

S=1335 I=63 E=6.26124e-153

Uncharacterized protein ORF2 in instable DNA locus

Pubmed 8277241

 

prodomImg

pubmed

19

419

S=1189 I=58 E=2.83879e-135

Probable starvation sensing protein SpaA protein

Pubmed 8921874

 

prodomImg

pubmed

31

173

S=553 I=72 E=3.28158e-58

Putative uncharacterized protein

Pubmed 17124322

 

prodomImg

pubmed

21

418

S=406 I=26 E=2.51042e-40

Putative uncharacterized protein

Pubmed 15231388

 

prodomImg

sp_Pdown

sp|P38104|RSPA_ECOLI

19

419

S=1499 I=67 E=6.13993e-173

Starvation-sensing protein rspA

sp_Pdown

sp|P32426|YIN2_STRAM

20

419

S=1335 I=63 E=4.26039e-153

Uncharacterized protein ORF2 in instable DNA locus

sp_Pdown

sp|Q6CYT9|DGOD_ERWCT

34

419

S=390 I=31 E=1.20323e-38

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|B2UCA8|DGOD_RALPJ

34

419

S=390 I=31 E=1.45765e-38

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|A6TFZ4|DGOD_KLEP7

34

419

S=389 I=31 E=1.66131e-38

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

Iprscan [G3DSA:3.20.20.120]

110

418

-

Iprscan [PTHR13794:SF5]

92

413

-

Iprscan IPR001354 [PTHR13794]

92

413

Mandelate racemase/muconate lactonizing enzyme

Iprscan IPR013341 [PF02746]

30

127

Mandelate racemase/muconate lactonizing enzyme, N-terminal

Iprscan IPR013342 [PF01188]

211

274

Mandelate racemase/muconate lactonizing enzyme, C-terminal

Iprscan IPR018110 [PS00908]

102

127

Mandelate racemase/muconate lactonizing enzyme, conserved site

PD937167

118

172

S=209 I=75 E=8.46892e-18

PDA1G956

19

59

S=181 I=83 E=1.68219e-14

PD308314

53

116

S=177 I=55 E=5.85254e-14

PDA1V373

395

419

S=135 I=100 E=7.57052e-09

PD003216

120

305

S=126 I=30 E=8.92703e-08

PDA0T1Q3

31

132

S=117 I=36 E=1.10919e-06

PDA1H2U3

395

419

S=111 I=76 E=6.17943e-06

Iprscan [SSF51604]

131

401

-

Iprscan [SSF54826]

17

131

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pZ1x5hZK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

108 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr41040.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr41040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr41040.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBntXPN4/XFF4834R_chr41040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.