Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr32360hslRXFF4834R_chr32360probable ribosome-associated heat shock protein Hsp15

hslR XFF4834R_chr32360
XFF4834R_chr32350
XFF4834R_chr32350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32370
XFF4834R_chr32370
ID hslR
AC XFF4834R_chr32360
LT XFF4834R_chr32360
OR XFF4834R_chr from 3724340 to 3724747 on strand -
DE probable ribosome-associated heat shock protein Hsp15
IP RNA-binding S4
CL 5.5.2 Temperature extremes GO:0009266
EC
GO InterPro
Molecular Function: RNA binding (GO:0003723)

Curated
PM
AN codon start changed to be the same as vesicatoria
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110711)
MW 15099 Da
SQ 135 aa
 
........10........20........30........40........50
| | | | |
MNLELEQARTVRLDVWLWAARFFKTRSLAKNAVETGKVDVAGQRPKPSRA
VRSGEQLRIDRGGEIFEITVAALSDVRGPAPVAQALYIESDSSREARAQW
RQQRAAERTGYRAPEGKPDKRARRLITALGDIDAL
Show or not Domain decomposition
 
XFF4834R

NP_641635.1 lcl|hslR-XAC1300

1

135

S=576 I=86 E=2.60286e-63

heat shock protein 15-like protein

XFF4834R

YP_363080.1 lcl|hslR-XCV1349

1

135

S=576 I=85 E=2.74265e-63

heat shock protein 15-like protein

XFF4834R

NP_636578.1 lcl|hslR-XCC1204

1

135

S=521 I=76 E=1.22257e-56

heat shock protein 15-like protein

XFF4834R

lcl|hslR-XALc_0958

1

135

S=435 I=67 E=3.79908e-46

probable ribosome-associated heat shock protein hsp15

pubmed

11

126

S=236 I=43 E=1.46996e-20

Heat shock protein 15 homolog ; DNA-binding RNA-binding

Pubmed 9286976

 

prodomImg

sp_Pdown

sp|P44754|HSLR_HAEIN

9

135

S=237 I=41 E=6.76794e-21

Heat shock protein 15 homolog ; DNA-binding RNA-binding

sp_Pdown

sp|Q44264|HSLR_AERSA

11

126

S=236 I=43 E=1.03752e-20

Heat shock protein 15 homolog ; DNA-binding RNA-binding

sp_Pdown

sp|P0ACG8|HSLR_ECOLI

11

124

S=202 I=39 E=1.30852e-16

Heat shock protein 15 ; DNA-binding RNA-binding Stress response

sp_Pdown

sp|P0ACG9|HSLR_ECOL6

11

124

S=202 I=39 E=1.30852e-16

Heat shock protein 15 ; DNA-binding RNA-binding Stress response

sp_Pdown

sp|P0ACH0|HSLR_ECO57

11

124

S=202 I=39 E=1.30852e-16

Heat shock protein 15 ; DNA-binding RNA-binding Stress response

PD021159

14

93

S=211 I=60 E=3.96026e-18

PDA1S3C6

109

134

S=123 I=92 E=2.09462e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lAr6RUzl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhxHoY9/XFF4834R_chr32360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhxHoY9/XFF4834R_chr32360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhxHoY9/XFF4834R_chr32360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhxHoY9/XFF4834R_chr32360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.