Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr17240osmCXFF4834R_chr17240probable osmotically inducible, stress-inducible membrane protein

osmC XFF4834R_chr17240
XFF4834R_chr_1849
XFF4834R_chr_1849
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17250
XFF4834R_chr17250
ID osmC
AC XFF4834R_chr17240
LT XFF4834R_chr17240
OR XFF4834R_chr from 1971518 to 1971952 on strand +
DE probable osmotically inducible, stress-inducible membrane protein
IP Peroxiredoxin, OsmC-like protein
CL 5.5.1 Osmotic pressure GO:0006970
EC
GO InterPro
Biological Process: response to stress (GO:0006950)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100730)
MW 15311.1 Da
SQ 144 aa
 
........10........20........30........40........50
| | | | |
MGISRHATAHWEGDLKTGKGQLSTPQSGLMDNTRYAFSSRFGDEKGTNPE
ELIAAAHAGCFTMALSAQLTEAGFPPTSLDTRADVDLSMEGGPQLSQIRL
KLKGVVPGIDEAKFRELADTAKKNCPVSKALSAVPISLETEFSS
XFF4834R

XFF4834R_chr02550 lcl|XFF4834R_chr02680441_0298869_f1_XFF4834R-XFF4834R_chr02550

46

130

S=118 I=37 E=2.79704e-08

XFF4834R

NP_643224.1 lcl|osmC-XAC2915

1

144

S=751 I=99 E=1.77202e-84

osmotically inducible protein

XFF4834R

NP_638093.1 lcl|osmC-XCC2745

1

144

S=748 I=98 E=4.82965e-84

osmotically inducible protein

XFF4834R

YP_364791.1 lcl|XCV3060

1

144

S=746 I=98 E=7.21266e-84

OsmC-like protein

XFF4834R

NP_640638.1 lcl|ohr-XAC0282

46

130

S=118 I=37 E=9.84808e-08

organic hydroperoxide resistance protein

XFF4834R

YP_362021.1 lcl|ohr-XCV0290

46

130

S=116 I=37 E=1.45796e-07

organic hydroperoxide resistance protein

XFF4834R

NP_635659.1 lcl|ohr-XCC0264

46

130

S=110 I=34 E=8.86239e-07

organic hydroperoxide resistance protein

XFF4834R

lcl|ohr-XALc_0160

46

130

S=98 I=34 E=2.35113e-05

probable organic hydroperoxide resistance protein

pubmed

1

144

S=362 I=52 E=8.32845e-36

Peroxiredoxin osmC EC=1.11.1.15 ; Acetylation Antioxidant Cytoplasm Oxidoreductase Peroxidase

Pubmed 1715407

 

prodomImg

pubmed

5

134

S=304 I=50 E=8.27991e-29

Osmotically inducible protein C

Pubmed 15111059

 

prodomImg

pubmed

46

131

S=124 I=35 E=6.36831e-07

Ohr protein Putative stress-induced protein Ohr

Pubmed 8825087

 

prodomImg

pubmed

46

130

S=118 I=37 E=3.3378e-06

Organic hydroperoxide resistance protein

Pubmed 9573147

 

prodomImg

pubmed

46

130

S=110 I=34 E=2.82588e-05

Uncharacterized protein ACIAD3023

Pubmed 9226277

 

prodomImg

sp_Pdown

sp|P0C0L3|OSMC_SHIFL

1

144

S=362 I=52 E=5.78773e-36

Peroxiredoxin osmC EC=1.11.1.15 ; Acetylation Antioxidant Cytoplasm Oxidoreductase Peroxidase

sp_Pdown

sp|P0C0L2|OSMC_ECOLI

1

144

S=362 I=52 E=5.78773e-36

Peroxiredoxin osmC EC=1.11.1.15 ; Acetylation Antioxidant Cytoplasm Oxidoreductase Peroxidase

sp_Pdown

sp|P0A0V5|OHR_XANCH

46

130

S=118 I=37 E=2.31955e-06

Organic hydroperoxide resistance protein

sp_Pdown

sp|P0A0V4|OHR_XANAC

46

130

S=118 I=37 E=2.31955e-06

Organic hydroperoxide resistance protein

sp_Pdown

sp|P70736|Y3023_ACIAD

46

130

S=110 I=34 E=1.9638e-05

Uncharacterized protein ACIAD3023

Iprscan IPR015946 [G3DSA:3.30.300.20]

1

144

K homology-like, alpha/beta

Iprscan IPR003718 [PF02566]

42

138

Peroxiredoxin, OsmC-like protein

Iprscan IPR019904 [TIGR03562]

4

140

Peroxiredoxin, osmotically inducible protein C, subgroup

PD685386

1

138

S=132 I=32 E=1.64138e-08

PD957751

42

142

S=112 I=28 E=4.02249e-06

Iprscan IPR003718 [SSF82784]

1

142

Peroxiredoxin, OsmC-like protein

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one E4DykIxL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOFXZWm/XFF4834R_chr17240.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOFXZWm/XFF4834R_chr17240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOFXZWm/XFF4834R_chr17240.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOFXZWm/XFF4834R_chr17240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.