Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr23090XFF4834R_chr25210645_2672865_f1_XFF4834R-XFF4834R_chr23090XFF4834R_chr23090putative TraB family membrane protein
  2. XFF4834R_chr42560XFF4834R_chr_4934358_4937300_f3_XFF4834R-XFF4834R_chr42560XFF4834R_chr42560putative TrwC relaxase
  3. XFF4834R_pla00270XFF4834R_pla00270putative conjugal transfer protein TrbG C-terminal fragment, pseudogene
  4. XFF4834R_pla00300XFF4834R_pla00300putative conjugal transfer protein TrbG N-terminal fragment, pseudogene
  5. XFF4834R_plb00180XFF4834R_plb00180putative TraD protein pseudogene
  6. XFF4834R_plc00180XFF4834R_plc00180putative mobilization protein TraI pseudogene

XFF4834R_chr25210645_2672865_f1_XFF4834R-XFF4834R_chr23090 XFF4834R_chr23090
XFF4834R_chr23080
XFF4834R_chr23080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23100
XFF4834R_chr23100
ID XFF4834R_chr25210645_2672865_f1_XFF4834R-XFF4834R_chr23090
AC XFF4834R_chr23090
LT XFF4834R_chr23090
OR XFF4834R_chr from 2671645 to 2672865 on strand +
DE putative TraB family membrane protein
IP Pheromone shutdown-related, TraB; Pheromone shutdown, TraB
CL 5.4 Genetic exchange, recombination GO:0006310
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110708)
MW 43907.3 Da
SQ 406 aa
 
........10........20........30........40........50
| | | | |
MTEQPPHVLDDALSGQPHRVVERDGVRYTLLGTAHVSLASVAAVQRAIGS
GRYDAVAVELDAQRLQALSDPDALARLDLVQVIRKGRVALFAANLALAAY
QRRLAKQLGIEPGAELKEAVNLARAQGLPVHLIDREVGLTFKRASGRLGF
FGKMKLAGGLLGGLFAADEVGEEEIEKLKQGDMLEASFGDFASESPELYE
TVIAERDQYMATRLREEVSADQREILAVVGAGHLAGLARHLEQDTAAPGP
LRESLEYVQQRKRIPWITLGILAVIVTGIGIGFWRGGLSMGADLLLQWAM
YTGGMAALGCLLAGSHPLSILTAAVVAPFKPFRLSVPTGAFAALVEVHMR
KPAYGDFLSLRDDAQTLRGWYRNRVSRVVLTFLLTNFGSMAGVWLAGVQI
FNRLHG
XFF4834R

NP_642622.1 lcl|traB-XAC2305

1

406

S=1676 I=83 E=0

pheromone shutdown protein

XFF4834R

YP_364234.1 lcl|XCV2503

1

406

S=1671 I=82 E=0

TraB family membrane protein

XFF4834R

NP_637557.1 lcl|traB-XCC2201

1

406

S=1572 I=78 E=0

pheromone shutdown protein

XFF4834R

lcl|XALc_1608

10

404

S=1128 I=59 E=1.59091e-129

putative trab family membrane protein

pubmed

18

406

S=222 I=28 E=4.11059e-18

Putative PrgY pheromone shutdown protein

Pubmed 18028413

 

prodomImg

pubmed

287

404

S=214 I=34 E=3.93196e-17

Pheromone cCF10 shut down protein PrgY ; Plasmid

Pubmed 1938961,8349565

 

prodomImg

pubmed

19

217

S=175 I=29 E=2.20235e-12

Pheromone cCF10 shut down protein PrgY ; Plasmid

Pubmed 1938961,8349565

 

prodomImg

pubmed

24

217

S=204 I=29 E=6.51424e-16

TraB protein ; Plasmid

Pubmed 12620853

 

prodomImg

pubmed

287

404

S=186 I=29 E=9.62788e-14

TraB protein ; Plasmid

Pubmed 12620853

 

prodomImg

pubmed

24

217

S=203 I=29 E=7.16993e-16

TraB ; Plasmid

Pubmed 7559344

 

prodomImg

pubmed

287

404

S=186 I=29 E=9.62788e-14

TraB ; Plasmid

Pubmed 7559344

 

prodomImg

pubmed

24

217

S=203 I=29 E=7.35995e-16

TRAB ; Plasmid

Pubmed 7559344,7559345

 

prodomImg

pubmed

287

404

S=186 I=29 E=9.37932e-14

TRAB ; Plasmid

Pubmed 7559344,7559345

 

prodomImg

pubmed

28

215

S=184 I=24 E=1.42536e-13

TraB ; Plasmid

Pubmed 8029329

 

prodomImg

sp_Pdown

sp|Q58760|Y1365_METJA

30

396

S=188 I=23 E=3.21318e-14

Uncharacterized protein MJ1365 ; Cell membrane Transmembrane

sp_Pdown

sp|Q58DF3|TRABD_BOVIN

17

216

S=184 I=31 E=1.2741e-13

TraB domain-containing protein

sp_Pdown

sp|Q9H4I3|TRABD_HUMAN

19

216

S=169 I=29 E=7.73833e-12

TraB domain-containing protein ; Alternative splicing

sp_Pdown

sp|Q99JY4|TRABD_MOUSE

19

216

S=167 I=29 E=1.34028e-11

TraB domain-containing protein

Iprscan IPR002816 [PF01963]

20

249

Pheromone shutdown-related, TraB

Iprscan IPR005230 [TIGR00261]

23

405

Pheromone shutdown, TraB

Iprscan [seg]

89

108

-

Iprscan [seg]

148

167

-

Iprscan [seg]

226

241

-

Iprscan [seg]

303

314

-

Iprscan [tmhmm]

266

288

-

Iprscan [tmhmm]

298

320

-

Iprscan [tmhmm]

378

400

-

PD186532

287

404

S=280 I=45 E=2.04923e-26

PD114144

119

275

S=214 I=39 E=1.63692e-18

PDA1E3X5

76

143

S=141 I=41 E=1.47608e-09

PD821986

242

286

S=137 I=60 E=3.81803e-09

PDA2D9R3

1

26

S=137 I=96 E=3.88519e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TkhLKALp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr23090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr23090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr23090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr23090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4934358_4937300_f3_XFF4834R-XFF4834R_chr42560 XFF4834R_chr42560
XFF4834R_chr42550
XFF4834R_chr42550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42570
XFF4834R_chr42570
ID XFF4834R_chr_4934358_4937300_f3_XFF4834R-XFF4834R_chr42560
AC XFF4834R_chr42560
LT XFF4834R_chr42560
OR XFF4834R_chr from 4934358 to 4937300 on strand +
DE putative TrwC relaxase
IP Conjugative relaxase region, N-terminal
CL 5.4 Genetic exchange, recombination GO:0006310
EC
GO InterPro


Curated
PM
AN part of TraI protein? interpro trwC relaxase : Relaxases are DNA strand transferases which function during the conjugative cell to cell DNA transfer. TrwC binds to the origin of transfer (oriT) and melts the double helix.
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120412)
MW 108185.6 Da
SQ 980 aa
 
........10........20........30........40........50
| | | | |
MLNVTPIRGNNQYAAAHYFSAADDYYAKEHPGEWQGQGAQALGLTGPVEQ
AQLSRLLDGQLPNGERIQTTFDPTDNKKRMGLDLTFSAPKSVSMQALVAG
DKDVTAAHDRAVTRALEQVERLAEARKKVNGKSYRERTANMVIGKFRHEM
SRAKDPQLHTHAVVLNMTQRTDGAWRALSNEDIFRVQHEVDALYKAELAR
GLQALGYAIRLVDDQGNFELDHISRDQIEAFSARSRVIEEALANEGKTRA
TATTLEKQIISLATRPRKDESDRELVKQYWVEKSRELGIDYGLRSQLDGR
TYEAGDSFGTRGRERGDAGNRIAAMSLPASLTPAQAVVQYAINHLTEREA
VVRETALTATALRRAVGLAGPDEVRAEIKRLAGQGALIEAVPAYRMADRK
DGPALSSAGWKSYLQELKGWSDKQAQQYVGNAIKQGSLVPAEKRYTTQKA
LAREKAILAIERTGRGAIEPIMTAAAVKTALEGTALNAGQRSAVETIVST
KNRFVGIQGDAGTGKTYTVNQAVALIKQASAVSEGYRTVALAPYGNQVKA
LKNEGLEAHTLASFLRTKDKPIDGKTIIVLDESGVVGARQMEQVMRVVEK
AGARMVLLGDTKQTEAIEAGKPFAQLQQDGMQTARISEIQRQKDHELKTA
VEHAAEGRVTPSLAHIKHVEELKEPIERHRAIVNDYIQLTEPERRETLIV
AGTNEARREINRMVRQSLDLTGKGREFETLTRVDMTQAQRRFAPSYQPGM
VIQPEKDDQKAGLTRGETYRVKEALPGNALVLQRQDGTTTTINPRKATQL
SVYRLERAELSVGDTVRINRNDPGRDLTNGDRMRVAGVIGGVVKLESVEQ
RDGRPARALELPTNRPLHLEHAYASTVHSAQGLTNDRALIALDTKSRTTS
MNLYYVAISRACHQARVYTNSVKELPAAIARRFDKTTALAIQRERQLQRR
AAGMQPKGAADGKQALQRQQLQQGVQRTYV
XFF4834R

YP_361538.1 lcl|XCVc0022

1

963

S=4844 I=96 E=0

putative TraI protein

XFF4834R

NP_644759.1 lcl|trwC-XACb0031

1

962

S=4660 I=92 E=0

TrwC protein

XFF4834R

lcl|trwC-XALp_3178

17

946

S=1782 I=44 E=0

probable conjugal transfer protein

XFF4834R

lcl|traI-XALq_3215

1

943

S=1651 I=41 E=0

probable mobilization protein trai

pubmed

1

963

S=3280 I=65 E=0

Putative TraC protein ; Plasmid

Pubmed 12534468

 

prodomImg

pubmed

1

963

S=3150 I=63 E=0

Putative plasmid transfer protein TraC

Pubmed 16707697,2175388

 

prodomImg

pubmed

1

963

S=3112 I=62 E=0

Putative TraC protein ; Plasmid

Pubmed 15288784

 

prodomImg

pubmed

1

963

S=3112 I=62 E=0

Putative TraC protein ; Plasmid

Pubmed 10719200

 

prodomImg

pubmed

14

945

S=2111 I=50 E=0

TrwC ; Plasmid

Pubmed 18268088

 

prodomImg

pubmed

14

945

S=2099 I=50 E=0

Mobilisation protein ; Plasmid

Pubmed 18268088

 

prodomImg

pubmed

14

945

S=2090 I=50 E=0

TrwC ; Plasmid

Pubmed 8289274,14625590

 

prodomImg

pubmed

14

945

S=2087 I=50 E=0

TrwC protein ; Plasmid

Pubmed 16391056,7022127

 

prodomImg

pubmed

1

951

S=1834 I=44 E=0

TraI ; Plasmid

Pubmed 16244860

 

prodomImg

pubmed

1

950

S=1606 I=40 E=0

Conjugal transfer protein ; Plasmid

Pubmed 18812424

 

prodomImg

sp_Pdown

sp|P14565|TRAI1_ECOLI

1

290

S=436 I=35 E=8.57513e-44

Protein traI EC=3.6.1.- ; Alternative initiation ATP-binding Conjugation DNA-binding Helicase Hydrolase Nucleotide-binding Plasmid

sp_Pdown

sp|P14565|TRAI1_ECOLI

411

675

S=239 I=32 E=6.24878e-20

Protein traI EC=3.6.1.- ; Alternative initiation ATP-binding Conjugation DNA-binding Helicase Hydrolase Nucleotide-binding Plasmid

sp_Pdown

sp|P14565|TRAI1_ECOLI

630

938

S=163 I=26 E=1.22427e-10

Protein traI EC=3.6.1.- ; Alternative initiation ATP-binding Conjugation DNA-binding Helicase Hydrolase Nucleotide-binding Plasmid

sp_Pdown

sp|P22706|TRAI2_ECOLX

14

290

S=434 I=36 E=1.59251e-43

Protein traI EC=3.6.1.- ; ATP-binding Conjugation DNA-binding Helicase Hydrolase Nucleotide-binding Plasmid

sp_Pdown

sp|P22706|TRAI2_ECOLX

411

675

S=238 I=33 E=9.332e-20

Protein traI EC=3.6.1.- ; ATP-binding Conjugation DNA-binding Helicase Hydrolase Nucleotide-binding Plasmid

Iprscan IPR014862 [PF08751]

8

291

TrwC relaxase

Iprscan IPR014059 [TIGR02686]

15

291

Conjugative relaxase region, N-terminal

Iprscan [seg]

35

44

-

Iprscan [seg]

349

370

-

Iprscan [seg]

964

977

-

PD018341

14

290

S=486 I=43 E=3.47556e-51

PDA1O561

893

962

S=284 I=79 E=1.12479e-26

PDA1Q7A9

290

348

S=238 I=78 E=3.82962e-21

PD856620

698

771

S=214 I=59 E=3.4107e-18

PD684234

417

501

S=201 I=53 E=1.00463e-16

PD005681

780

892

S=179 I=40 E=5.99122e-14

PDA1Y118

666

697

S=150 I=91 E=1.54581e-10

PD559128

371

411

S=146 I=71 E=4.76009e-10

PD293860

500

576

S=137 I=44 E=6.50979e-09

PDA046R3

451

616

S=114 I=26 E=3.55803e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LSKW515M)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

99 hits
swiss-prot

Swiss-Prot ncbi-blastp

9 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr42560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr42560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr42560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_chr42560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00270
XFF4834R_pla00510
XFF4834R_pla00510
Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence
XFF4834R_pla00290
XFF4834R_pla00290
ID
AC XFF4834R_pla00270
LO XFF4834R_pla00270
DE putative conjugal transfer protein TrbG C-terminal fragment, pseudogene
CL 5.4 Genetic exchange, recombination GO:0006310
GO InterPro


Curated
PM
AN trbG which is interrupted by the IS XFF4834R_pla00290, the C-terminal part of the gene is XFF4834R_pla00300
CC MODEL:
CC STATUS: curated by carrere (20111020)
SQ 648 nt
 
........10........20........30........40........50
| | | | |
ATCGGGAGATGATGTCCGGATCGCGCCGAAAATGGTGCAAATTCCGACTA
TTCAAACGCAGCTCCTTGGAGAAATGCACCTCCCGCGTCCTCAGCTCTCA
TTAATCAGACCATCCTTAGCCAGGTCACCAGCGGCACCGATGCCGGCGAG
CAAGTGCATCTGGTGCTCAAGGCGGTGGAGCCAGGTCTGACCAACGACCT
CTTCATTGCCACCAATCGGCGCACCTACCTGGTCACCGCGCGCAGCGTGG
CCGATTGGAGCATGCCCAGCGTGTCGTGGCAGTACCCGATGGACACCTGG
AAGGCCCAGCAAGCCGTGGCGGCCAAGCGCGAAGCCGTCCAGCCTGTGGC
AGTCGCCCCGGATGCATTGCACTTCAACTACGACATCAAGGGCGGCCGCT
ACTCCTGGAAGCCAATGCAAGTCTTTGACGATGGCGCGCAAACCTATATC
CGCATGCCGGCCACGCTCAATGCGACCGATGCCCCGGCGCTGTTCCTGAT
CGAGAAGGGCGAACCGTTGCTGGTGAACTACCGCGTCAAAGGCGTGGCGA
ACGGCACCACCGGCCCGACCTACATCGTAGATCGCGTGTTTGATCGCGCC
GAGCTGCGCGTGGGTGCGAAGCAAACCATCACGATCCGCCGTCGCTAA
Show or not Domain decomposition
 
Iprscan IPR010258 [PF03524]

46

210

Conjugal transfer, TrbG/VirB9/CagX

Iprscan [seg]

61

71

-

Iprscan [seg]

89

102

-

Iprscan [seg]

9

26

-

Iprscan [seg]

51

64

-

Iprscan [seg]

166

182

-

Iprscan [seg]

12

23

-

Iprscan [seg]

13

24

-

Iprscan [seg]

5

16

-

Iprscan [SignalP-NN(euk)]

1

16

-

Iprscan [SignalP-NN(euk)]

1

18

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0jkYjUID)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00270.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00270.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00270.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00270.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_pla00300
XFF4834R_pla00270
XFF4834R_pla00270
Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence
XFF4834R_pla00310
XFF4834R_pla00310
ID
AC XFF4834R_pla00300
LO XFF4834R_pla00300
DE putative conjugal transfer protein TrbG N-terminal fragment, pseudogene
CL 5.4 Genetic exchange, recombination GO:0006310
GO InterPro


Curated
PM
AN trbG is interrupted by the IS XFF4834R_pla00290.
CC MODEL:
CC STATUS: curated by carrere (20111021)
SQ 527 nt
 
........10........20........30........40........50
| | | | |
ATGCAAACCATGAAGACGACCGTTCTGCCGTTGCTGTTGTTGTCCGCCGG
CATCGCCAATGCCCAAACTACGCCACAGGTGCCCGCGATCACCAGCGCGC
TCAACGACAACAGCACGGCGACCGCCAATGCGACCCCGTTGGCCAACAAC
GCCCCCGCTCCCGCACCCGCCTATGTGCCGCCGCCCTTGCAGCCGGAGCA
TGTCTCGCCGCGCGTCGCCAAAGCGCGGTCTGACTTCGACAGCAAGCAGC
GCGCCCAGGTGGCCGAGTACGTCGGCCAGGCACGGCAAGTGCCGACCAGC
TCCAGCACGGCCAATGTGGGCGGACAGACGATCTTTACCTATCGGCCTGG
TGCGCTCTATACGATCTATGTCGGCGCCGGCCGTCAGACCGTTATCGACT
TCCAGCCAGGCGAACAGCTGACGGGCGAAGTCAACGGCTCCGATACGGTG
CGGTGGCTCATTAGGGAAGGTCTGATCAACTCACCACAGATGCGCGACAC
TACCGTCTCATGTAGAGGACTCATCCA
Show or not Domain decomposition
 
Iprscan IPR010258 [PF03524]

111

156

Conjugal transfer, TrbG/VirB9/CagX

Iprscan [seg]

39

65

-

Iprscan [seg]

1

12

-

Iprscan [seg]

24

69

-

Iprscan [seg]

7

18

-

Iprscan [seg]

26

42

-

Iprscan [seg]

56

72

-

Iprscan [seg]

2

15

-

Iprscan [seg]

99

133

-

Iprscan [seg]

140

154

-

Iprscan [seg]

20

33

-

Iprscan [seg]

37

62

-

Iprscan [seg]

5

19

-

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [SignalP-NN(euk)]

1

20

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one t4cL7lQd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00300.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00300.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00300.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_pla00300.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plb00180
XFF4834R_plb00200
XFF4834R_plb00200
Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence
XFF4834R_plb00190
XFF4834R_plb00190
ID
AC XFF4834R_plb00180
LO XFF4834R_plb00180
DE putative TraD protein pseudogene
CL 5.4 Genetic exchange, recombination GO:0006310
GO InterPro


Curated
PM
AN Frameshift at position 017447 (previously XFF4834R_plb_0024 and 0025). Orthologous gene is for instance traD in Xanthomonas arboricola pv. pruni str. CFBP 5530.
CC MODEL:
CC STATUS: curated by carrere (20111021)
SQ 1595 nt
 
........10........20........30........40........50
| | | | |
ATGACGGTTGGGCAACTTCTGACGCTGGGCTTTTTGGGCGTCCCTGCCTT
GGCCCTGGTACGCACCATCCTGGCCGCTGCACGCGGCAAGATGCGGTCTT
CGCCGATCGCCTGGGCATGGATAGGCGTTTGGTCGGTGGCAGTGGTCTAC
GGCATTGGTTCGACCGCCCTACGGTTTGCCAAGGATGGCAAGCCGTCCAC
CCTGCTCGCGTTCGGCGTTGCGGCTATCTCCGTGTTCTGCTGGGTCCGCA
TGTTCCGGCACCTGGAAGCAAGCGCCGCAAGACAGAACCGGGAAAGGGTC
GTTCGGGGACGCAAGTCGTCGCGGGGAAGGCCCTGCAAGCCGGCATGCAC
GGCAGCAAGGCCAGGCCCGCCGACGTGGACATAGAGATTGGCGGGGTGGT
GCTTCCGCGCATGCTGGAAGCGCAGCACATGCTGTTTGCAGGCACTACCG
GGGCCGGCAAGACGCAAGCGATTAACCGCGTCCTGCGCGCTGTACGTCAA
CGCGGCGAACGCGCGTTGATTGCCGATCCGGCGGGAGGTTTCTTCTCGCG
CTTCGCGCGTTCCGGCGACCTGTTGTTCAACCCCTTTGACGGGCGCACGG
TGGATTGGTCGCCGTTCGCTGAAATCAGGCACGACTACGATTGCCAGAGG
ATCGCCAAGGCTGCCGTGCCGGACGGCACGGGCGAGGGGGCCGAATGGCA
CCACTACGCGCAAACCTTGCTCGGTGAGACCATGCTCGCGCTGCACCGGA
ACGGTGAGCACTCGGTGAAACGTCTGCTCCACTTCGTGAGCGCGGCCGAA
ACGAAGGAACTAGCCGCCCTGCTCGCCGGCACGCCTGCCGCCATCCTGAC
GGCCAAGGGCAATGACAAGATGCTCAACAACACGCGGGGCATCATCGCCA
CCTACCTGGGGGCCTGGCGGTATCTACCGGACGCGGGCAGCTTCTCCGTT
CGCTCCTGGGTACAGGACGAAGGGGGCGACGGTTGGCTGTTCGTGACGTA
CCGGGACGATCAAATGGGCCTCCTGCGCGGCCTGGTCGCCTCGATCTTGG
AGCTGGGCATTGTCGAAGGTCTGAGCTTGTCCGAAAGCCCGAACCGAGCG
CTGTGGTACGTGTTCGATGAGGTCGACTCGCTCGGCAAAGTGTCGAGTTT
GCGCGGTGGACTGACCAAGCTGCGCAAGTACGGTGGGCGGTGCGTCCTGG
GCCTGCAAACGGTGTCGCAGCTCCGAGAAACCTACGGCCGCGACGAAGCC
CAAACGCTACTGGCTAACCTTTCAACCAAGTTGATTTTGCGCGCGGGTGA
CAACGAAACGGCCGAGTATTTCAGCAAAGAACTAGGCGAACAGGACGTTG
ATCGCCTTCAAATGACGACAGGACAAGGAACGAACTCCGGGGGCCTGTTC
AACCCTTCGCAATCCTCACAATCGGCAAACACCAGCTTCAATTTGCAGCG
GGTGCGCCAAGCGGCGGTCATGTCGTCAGAGATCCTCAACCTGCCCGATC
TGGAAGGCTTCTTGAAAATGCCAGGCCAGCCAGTGGGGGCCGTGACGATC
GCATATGAGGGGATGCCGGAGCTTCAGCCGGGCTTTGTGGCCTAG
Show or not Domain decomposition
 
Iprscan [G3DSA:3.40.50.300]

83

530

-

Iprscan [PF10412]

127

515

-

Iprscan [seg]

97

110

-

Iprscan [seg]

73

87

-

Iprscan [seg]

91

103

-

Iprscan [seg]

21

31

-

Iprscan [seg]

11

24

-

Iprscan [seg]

20

40

-

Iprscan [seg]

270

275

-

Iprscan [seg]

3

16

-

Iprscan [seg]

70

83

-

Iprscan [seg]

61

74

-

Iprscan [seg]

5

17

-

Iprscan [seg]

22

35

-

Iprscan [seg]

26

37

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [SignalP-NN(euk)]

1

19

-

Iprscan [SignalP-NN(euk)]

1

16

-

Iprscan [SignalP-NN(euk)]

1

15

-

Iprscan [SignalP-NN(euk)]

1

23

-

Iprscan [SignalP-NN(euk)]

1

15

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [SignalP-NN(euk)]

1

19

-

Iprscan [tmhmm]

5

24

-

Iprscan [tmhmm]

36

58

-

Iprscan [tmhmm]

68

85

-

Iprscan [SSF52540]

141

510

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tDtocpeO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

28 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plb00180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plb00180.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plb00180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plb00180.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plc00180
XFF4834R_plc00480
XFF4834R_plc00480
Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence
XFF4834R_plc00290
XFF4834R_plc00290
ID
AC XFF4834R_plc00180
LO XFF4834R_plc00180
DE putative mobilization protein TraI pseudogene
CL 5.4 Genetic exchange, recombination GO:0006310
GO InterPro


Curated
PM
AN Frameshift at position 013162 (previously XFF4834R_plc_0051 and 0052). Orthologous gene in Xanthomonas is XALq3215.
CC MODEL:
CC STATUS: curated by carrere (20111021)
SQ 2870 nt
 
........10........20........30........40........50
| | | | |
ATGATCGATATCACCGTCATCACGCGCCAGTCGGTCGGCAAAGTCGTGTC
CTACTATGCCGACGGCGCCGATGACTACTACGCCAAGGACGGCACGGCGA
TGCAATGGCAGGGCGAGGGAGCGGCCGCCCTCGGGCTGGAGGGTGAAGTC
GACCGCAAACGGTTCGGCGAGCTCCTGGATGGCCGCATTGATGAGCACAC
TCGCACGCGTCGCATTCCCCCGACCGCCGAAGCTGCCCGCAAGGAGCGAC
TGGCCTACGACCTGACGTTCAGTGCCCCAAAGGGTGTGTCCCTGCAGGCT
TTGGTCCACGGAGACCGCCGTATCGTCGAGGCACATGAGCGTGCCGTCGC
CGCAGCTGTGCGCGAAGCCGAACATTTGGCGATGGCCAGGTCGACGAACA
ACAAAAAAACCAGCGTCGAACATACGGGAAAACTGGTGGTAGCGAAGTTT
CGCCACGAGACCTCGCGTGCGCTCGATCCTGATCTGCATACCCATGCCGT
CGTACTGAATCTGACCCAGCGGGCCGATGGCCAGTGGCGCGCGCTCACCA
GCGACGGCATCGTCAAATCGCTGCGTCACTTGGGCAACGTCTACAAATCA
GAGCTGGCCCGCGAGTTGGAGAAAGCTGGCTTTACGCTTCGCTACGACCG
CAACGGTACGTTCGATTTGGCGCACTTCACTGAACATCAAATCCGAGAGT
TCAGCGCCCGCAGCCAGCAGATTGAGGCGGCCTTGGCGGCCAAGGGGCTC
AACCGCGAGACCGCAACCCATGCCGAGAAGAACCAAGCTGCCCTTTCTAC
GCGCCAGCGCAAGGTTGAAGTCAACCGTGAAGCGGTCCGGCAGGAGTGGC
AGAAGCGCGCGGGCGACCTTGCCATCGACTTTCACAGTCGGCAGTGGGAG
GGCGCCGGCCGGGATGACGTCGACGATCGCGCCAAGCGGCTACCACCGAA
GGAAATCGAAAAGCCACTTGAGCACCATGCCGACAAGGCCGTCCAGTTCG
CGATCAAATCGCTGACAGAGCGCAACGCCATCGTGAAAGAGTCCGCGCTC
TTGGAGGTAGCGTTGACACACGGGTTCGGGCGATTGACGACCCGGGACGT
TCGGGGCGCGCTTGATCGGGCTACCCGGTCCGGGCATCTCATTCGTGATC
TGCCCGTCTATGTCTCTATGAATCCCGCCGACAAGAAGAAGGCAACGCAA
AAGATGGTCCGGCGCTCTCTCGCCAAGAGTGGGTCGCCACGCTGCAAGCC
AGTGGTAAGTCGAAAGCCGAGGCGATGCGTCTGGTCGACATGGGGGTGCG
TAGCGGGCGTCTTGAGAAGCAGGAACCGCGCTTCACGACCCACATCGCGC
AGAAGCGAGAACGGGACATCCTGCAGACGGAACAACGCAATCGGGGCGTG
ATGCAAAGCCGGATTTCGTCCGAAATCTCGCTTGCTTTCCTGGCCGACAA
ATCGCTGAACGACGAGCAGCGCCGCGCAGTGCAGCACATTGTGGAAAGCA
CAAACCGCTTCATAGGCGTCCAGGGATATGCCGGCACTGGCAAGACCCAC
ATGACTAAGGCCGCCAGAGATCTTCTCGAGGCCAACGGCTTTCACGTCAT
CACTATGGCGCCGTACGGGTCGCAGAAAAAGGCCCTGGAAGAGGCCGGCC
TGGAAAGCAGCACGGTGCAAGCATTCCTGCGCGCCAAGGACAAGAAGATC
GATGAAAACAGCGTTGTCTTCGTTGACGAGGCGGGCGTTATTCCAGCGCG
TCAGATGCTCGAAATCATGAGAACGATCGAGGCGCATGGCGCCCGTGCCG
TCTTTCTCGGAGACATCGCCCAAACCAAGGCAATCGAGGCTGGCAAACCA
TTCGATCAGCTGCAGAAAGCCGGCATGGAGACTGCACGCTTGGTCGAAAT
TCGCCGGCAACAAGATCCGCAACTTTTGGAAGCCGTCAAGTTGGCTGCTG
AGGGGCAGTCAACAAAATCCGTGGCTAATATCCGCCAGATACTGACGGAG
AAGGAACCGGATCTGCGGTACAGCAGGATCGTCAAGCACTACGCCGAGCT
GCCCAAGCACGACCGTGATCAGACCCTCATCATCACGGGCACCAATGAAA
GCCGTAAGGCGCTGAATGATGGTGTACGGGAGGCCCTAGGCATGAAAGGG
CGGGGGGAGGAGTACAAGTTACTCAATCGCCTGGACACGACCCAGGCCGA
GCGCCAGCACAGTCGCTACTACGAGAAAGGTAGCGTAATCGTGCCAGAGC
GAAGCTACGCAAATGGCCTGCAGCGCGGTGAATACTACACGGTGATCGAC
ACTGGCCCGGGCAATCGTTTGACAGTGCGCAACGAGGCTGGCCAGCAGAT
CCAGTTCTCACCGATGCGCTGCCCCAAGCTCAGTGTTTACAGCGTGGAGA
GGACGGAATTAGCGGTGGGCGACCAAGTGAAGGTCACCCGCAACAATGCC
GACCTCGATCTTGCTAACGGTGATCGTTTCGTCGTTCATCGCGTCGGCAG
GCAGGAGATCGAACTGAGGGGACAGGATGGCCGCCGTATCACATTCGACG
CAAGGACGCCGATGTTCGTCGGTCTAGCCTACGCATCCACCGTCCATAGC
TCGCAGGGACTAACCTGCGGCACGGTATTGATCAATATCGAAACGAAATC
ACGGACTACCACCAAGGATGTCTACTACGTCGGCGTCTCGCGGGCACGCA
ACGAGGCGATCATCTACACCGACGACTCCGGCAAGTTGGCCAAAGCCATT
AGCCGTGACAGCCTGAAGACGGCCGCGCTCGAAATAAAAAAACTTGCTGG
ACACGCAATCGATCGGACGCTCAAGACGCATTCGGGTCCAAGTGACCACC
AAATGGGCGTTGGCCGTTAG
Show or not Domain decomposition
 
Iprscan IPR014862 [PF08751]

10

293

TrwC relaxase

Iprscan [PF01443]

439

524

-

Iprscan IPR014059 [TIGR02686]

17

294

Conjugative relaxase protein, N-terminal domain

Iprscan [seg]

18

33

-

Iprscan [seg]

38

49

-

Iprscan [seg]

106

129

-

Iprscan [seg]

18

37

-

Iprscan [seg]

7

23

-

Iprscan [seg]

23

35

-

Iprscan [seg]

1

14

-

Iprscan [seg]

16

32

-

Iprscan [seg]

107

117

-

Iprscan [seg]

153

164

-

Iprscan [seg]

1

13

-

Iprscan [seg]

15

28

-

Iprscan [seg]

12

23

-

Iprscan [seg]

10

23

-

Iprscan [seg]

33

46

-

Iprscan [seg]

1

11

-

Iprscan [seg]

19

31

-

Iprscan [seg]

169

183

-

Iprscan [seg]

14

27

-

Iprscan [seg]

25

36

-

Iprscan [seg]

58

71

-

Iprscan [seg]

39

54

-

Iprscan [seg]

57

80

-

Iprscan [seg]

45

58

-

Iprscan [seg]

21

34

-

Iprscan [seg]

63

87

-

Iprscan [seg]

64

88

-

Iprscan [seg]

15

48

-

Iprscan [SignalP-NN(euk)]

1

23

-

Iprscan [SignalP-NN(euk)]

1

11

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan [SignalP-NN(euk)]

1

60

-

Iprscan [SignalP-NN(euk)]

1

44

-

Iprscan [tmhmm]

4

23

-

Iprscan [tmhmm]

44

66

-

Iprscan [SSF55464]

1

313

-

Iprscan [SSF52540]

101

527

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kaKVLV3m)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

43 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plc00180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plc00180.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plc00180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmDVR1W/XFF4834R_plc00180.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.