Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31750eraXFF4834R_chr31750probable GTP-binding protein Era

era XFF4834R_chr31750
XFF4834R_chr31740
XFF4834R_chr31740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31760
XFF4834R_chr31760
ID era
AC XFF4834R_chr31750
LT XFF4834R_chr31750
OR XFF4834R_chr from 3644942 to 3645841 on strand -
DE probable GTP-binding protein Era
IP GTP-binding protein, HSR1-related; Small GTP-binding protein; K homology-like, alpha/beta
CL 5.2 Cell cycle physiology GO:0007049
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
Molecular Function: GTP binding (GO:0005525)
Molecular Function: RNA binding (GO:0003723)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101027)
MW 32815.6 Da
SQ 299 aa
 
........10........20........30........40........50
| | | | |
MSEIISPHRSGSVAVIGRPNVGKSTLTNALVGAKVSIVSNRPQTTRHRLL
GIATFPEGQLVLVDTPGLHREQKRAMNRVMNRAARGSLEGVDAAVLVIEA
GRWDEEDTLAFRVLSDAGVPVVLVVNKVDRLKDKTALFPFLAQVSEGRTF
AAVHPVSALKRKGLDALVGDLLKLVPEAEAMFGEDEITDRSQRFLAGELV
REQLMRQLGEELPYATTVEIERFAEDGALLRIGAVIWVEREGQKAIVIGK
GGTRLKEIGGKARLQMERLFGAKVFLETWVRVREGWSDDEAALKAFGYE
Hamap ERA_MF_00367 raw_score=5545 norm_score=33.544

GTP-binding protein era homolog [era].

XFF4834R

XFF4834R_chr21240 lcl|der-XFF4834R_chr21240

13

177

S=151 I=32 E=7.50135e-12

predicted GTP-binding protein

XFF4834R

XFF4834R_chr21240 lcl|der-XFF4834R_chr21240

13

133

S=135 I=36 E=6.18174e-10

predicted GTP-binding protein

XFF4834R

XFF4834R_chr42940 lcl|mnmE-XFF4834R_chr42940

9

137

S=106 I=37 E=2.14533e-06

GTPase

XFF4834R

NP_641661.1 lcl|era-XAC1326

1

299

S=1396 I=96 E=4.32755e-162

GTP-binding protein Era

XFF4834R

YP_363108.1 lcl|era-XCV1377

1

298

S=1385 I=95 E=8.53545e-161

GTP-binding protein Era

XFF4834R

NP_636648.1 lcl|era-XCC1274

1

299

S=1352 I=93 E=9.6114e-157

GTP-binding protein Era

XFF4834R

lcl|era-XALc_2540

1

299

S=1327 I=86 E=1.01022e-153

probable gtp-binding protein era

XFF4834R

lcl|engA-XALc_1586

13

189

S=164 I=34 E=7.94821e-13

probable gtp-binding protein enga.

XFF4834R

lcl|engA-XALc_1586

13

133

S=137 I=34 E=1.39735e-09

probable gtp-binding protein enga.

XFF4834R

NP_642347.1 lcl|engA-XAC2021

13

177

S=150 I=32 E=3.74891e-11

GTP-binding protein EngA

XFF4834R

NP_642347.1 lcl|engA-XAC2021

13

133

S=135 I=36 E=2.21814e-09

GTP-binding protein EngA

XFF4834R

YP_363803.1 lcl|engA-XCV2072

13

177

S=150 I=32 E=4.01973e-11

GTP-binding protein EngA

XFF4834R

YP_363803.1 lcl|engA-XCV2072

13

133

S=135 I=36 E=2.35773e-09

GTP-binding protein EngA

pubmed

9

298

S=701 I=50 E=2.58631e-76

GTP-binding protein era homolog ; Nucleotide-binding RNA-binding

Pubmed 10438789

 

prodomImg

pubmed

5

299

S=691 I=44 E=3.96148e-75

GTP-binding protein era homolog ; Nucleotide-binding RNA-binding

Pubmed 7830573

 

prodomImg

pubmed

10

298

S=682 I=47 E=4.75347e-74

GTP-binding protein era ; Cell membrane Nucleotide-binding Phosphoprotein RNA-binding

Pubmed 9150881

 

prodomImg

pubmed

5

298

S=674 I=46 E=4.31516e-73

GTP-binding protein era ; Cell membrane Nucleotide-binding Phosphoprotein RNA-binding

Pubmed 3097637

 

prodomImg

pubmed

5

298

S=561 I=37 E=2.12324e-59

GTP-binding protein Era ; Nucleotide-binding RNA-binding

Pubmed 17636987

 

prodomImg

pubmed

8

298

S=555 I=37 E=1.27944e-58

Uvs062 ; GTP-binding Nucleotide-binding RNA-binding

Pubmed 14532085

 

prodomImg

pubmed

9

299

S=529 I=40 E=1.50617e-55

GTP-binding protein era homolog ; Nucleotide-binding RNA-binding

Pubmed 9513267

 

prodomImg

pubmed

9

299

S=524 I=39 E=7.36239e-55

GTP-binding protein era homolog ; Nucleotide-binding RNA-binding

Pubmed 10220158

 

prodomImg

pubmed

9

299

S=519 I=38 E=2.49534e-54

GTP-binding protein era homolog ; Nucleotide-binding RNA-binding

Pubmed 8407794

 

prodomImg

pubmed

9

298

S=519 I=37 E=2.5839e-54

GTP-binding protein era homolog ; Nucleotide-binding RNA-binding

Pubmed 10871354

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

3

186

-

Iprscan IPR015946 [G3DSA:3.30.300.20]

191

298

K homology-like, alpha/beta

Iprscan IPR005662 [MF_00367]

8

296

GTP-binding protein Era

Iprscan IPR002917 [PF01926]

11

129

GTP-binding protein, HSR1-related

Iprscan IPR004044 [PF07650]

234

298

K Homology, type 2

Iprscan IPR005225 [TIGR00231]

8

173

Small GTP-binding protein

Iprscan IPR005662 [TIGR00436]

11

281

GTP-binding protein Era

Iprscan IPR004044 [PS50823]

200

284

K Homology, type 2

Iprscan [seg]

74

85

-

PD004541

173

282

S=261 I=53 E=3.12161e-24

PDA1T0P8

277

299

S=119 I=96 E=5.61672e-07

PD000414

15

49

S=111 I=63 E=5.01067e-06

PD215796

13

103

S=109 I=34 E=9.8052e-06

PD776216

120

168

S=108 I=45 E=1.40185e-05

PDA1X5A7

277

299

S=101 I=78 E=9.13696e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one t4ZVGYSd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

101 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Oz0pV/XFF4834R_chr31750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Oz0pV/XFF4834R_chr31750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Oz0pV/XFF4834R_chr31750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_Oz0pV/XFF4834R_chr31750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.