Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr21900XFF4834R_chr23860248_2537794_f2_XFF4834R-XFF4834R_chr21900XFF4834R_chr21900putative competence related DNA transformation transporter protein

XFF4834R_chr23860248_2537794_f2_XFF4834R-XFF4834R_chr21900 XFF4834R_chr21900
XFF4834R_chr21890
XFF4834R_chr21890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21910
XFF4834R_chr21910
ID XFF4834R_chr23860248_2537794_f2_XFF4834R-XFF4834R_chr21900
AC XFF4834R_chr21900
LT XFF4834R_chr21900
OR XFF4834R_chr from 2535248 to 2537794 on strand +
DE putative competence related DNA transformation transporter protein
IP Beta-lactamase-like; ComEC/Rec2-related protein
CL 5.11 DNA uptake GO:0009290
EC
GO InterPro
Biological Process: establishment of competence for transformation (GO:0030420)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100924)
MW 90404.9 Da
SQ 848 aa
 
........10........20........30........40........50
| | | | |
MATDSMEVSAHPAPPQMGSAVVIAAALLLGVVACAWSPILLPRMVYAGCV
CVALLGSGATVWLRPCWSALLLAGAAALLGFGAMGWQVTGALQAQLLPRD
ETRDVTVRGQMVGLPIAEQRRTRFQLRVDEAAAQPPALRGKLLQVAWYDD
FGAERIGSRVALHAGARWQLRLKLRAPRGLRNPGGFDAERQALAQRIAAT
GYVRMPATARQTVPPQGVDAWRERMSHRIAERVGGPSAPYLRALALGDTR
GLDDTAWATLRATGLSHLIAISGFHVGLVGAFFALLVAGIWRWQPRLGTF
MPRLHAASIAALLGAAAYALLAGLALPTVRTVLMIAVVALARVLRRRAST
AHVLSLALLAVLLWDPLSVLVAGFWLSFAGVAWLVWCLPSDDRAIVRGFL
SAQTVATVGLLPLTVSLFGQASLVGPFANVVAIPWWTFVVVPLCLLGTAL
EAIYPGTGVWAWQLAGWCFELTWPGFVWLGQTAVALWWVPESDGVALIAA
LLGAFWLLLPRATPGKSLAALLWLPLLWPDRELPAAGEAEVQLLDVGQGL
AVLVRTQRHALLFDTGPAVRDGFDAGERVVLPALRALGVRRLDAIVLSHA
DADHAGGYAAVRTGLPVARTAAPPGAPLDVTARCRAGQQWEWDGVRFRFL
HPGVGFPYLRNQSSCVLRVETAYASALLPGDIGDIVERRLLRGHASDLRA
DLVVVPHHGSADGSHAGFIAATGARLALVSSGHGNRFGHPRAEVVQRWKS
GGAEVLDTAQSGAIRVWLGAAGLQLRERRRWQPRLWDAAERRRSAAILSV
SEQAAALPEESNRVGAGQGRRLADGAVAVAGRDRPGDRAGASVEPAPQ
XFF4834R

NP_642405.1 lcl|comA-XAC2084

1

848

S=3493 I=84 E=0

competence protein

XFF4834R

YP_363982.1 lcl|XCV2251

1

848

S=3395 I=82 E=0

competence-related DNA-transformation transporter

XFF4834R

NP_637484.1 lcl|comA-XCC2123

36

802

S=2584 I=69 E=0

DNA uptake/competence protein

XFF4834R

lcl|XALc_1818

88

847

S=2031 I=57 E=0

putative competence related dna transformation transporter protein

pubmed

152

784

S=370 I=24 E=1.06499e-35

Competence factor ComA

Pubmed 11425734

 

prodomImg

pubmed

537

782

S=326 I=37 E=2.26443e-30

Competence protein comA ; Cell inner membrane Transmembrane Transport

Pubmed 7934834,8830266

 

prodomImg

pubmed

165

450

S=188 I=29 E=1.25569e-13

Competence protein comA ; Cell inner membrane Transmembrane Transport

Pubmed 7934834,8830266

 

prodomImg

pubmed

535

786

S=313 I=31 E=1.00482e-28

Competence protein

Pubmed 14742218

 

prodomImg

pubmed

372

764

S=256 I=25 E=6.92653e-22

ComEC protein

Pubmed 15558816

 

prodomImg

pubmed

405

765

S=251 I=24 E=2.60654e-21

ComE operon protein 3 ; Cell membrane Competence Transmembrane Transport

Pubmed 7968523

 

prodomImg

pubmed

540

783

S=240 I=29 E=5.60938e-20

Recombination protein 2 ; Cell inner membrane Competence Transmembrane Transport

Pubmed 8063112

 

prodomImg

pubmed

168

278

S=145 I=34 E=2.2039e-08

Recombination protein 2 ; Cell inner membrane Competence Transmembrane Transport

Pubmed 8063112

 

prodomImg

pubmed

543

771

S=187 I=34 E=1.64538e-13

Competence factor ComEC

Pubmed 11425734

 

prodomImg

pubmed

167

294

S=149 I=35 E=6.7333e-09

Competence factor ComEC

Pubmed 11425734

 

prodomImg

sp_Pdown

sp|P51973|COMA_NEIGO

537

782

S=326 I=37 E=1.56056e-30

Competence protein comA ; Cell inner membrane Transmembrane Transport

sp_Pdown

sp|P51973|COMA_NEIGO

165

450

S=188 I=29 E=8.6538e-14

Competence protein comA ; Cell inner membrane Transmembrane Transport

sp_Pdown

sp|P37443|YCAI_ECOLI

386

780

S=302 I=28 E=1.15732e-27

Uncharacterized protein ycaI ; Cell membrane Transmembrane

sp_Pdown

sp|P39695|COMEC_BACSU

405

765

S=251 I=24 E=1.79634e-21

ComE operon protein 3 ; Cell membrane Competence Transmembrane Transport

sp_Pdown

sp|P44408|REC2_HAEIN

540

783

S=240 I=29 E=3.86579e-20

Recombination protein 2 ; Cell inner membrane Competence Transmembrane Transport

Iprscan [G3DSA:3.60.15.10]

551

709

-

Iprscan IPR004477 [PF03772]

244

513

ComEC/Rec2-related protein

Iprscan [PF00753]

548

708

-

Iprscan IPR001279 [SM00849]

548

733

Beta-lactamase-like

Iprscan IPR004797 [TIGR00361]

111

762

Competence protein ComEC/Rec2

Iprscan IPR004477 [TIGR00360]

265

443

ComEC/Rec2-related protein

Iprscan [seg]

20

35

-

Iprscan [seg]

69

83

-

Iprscan [seg]

304

326

-

Iprscan [seg]

336

370

-

Iprscan [seg]

518

529

-

Iprscan [seg]

599

610

-

Iprscan [tmhmm]

21

40

-

Iprscan [tmhmm]

44

63

-

Iprscan [tmhmm]

68

90

-

Iprscan [tmhmm]

269

291

-

Iprscan [tmhmm]

304

326

-

Iprscan [tmhmm]

366

388

-

Iprscan [tmhmm]

395

417

-

Iprscan [tmhmm]

432

454

-

Iprscan [tmhmm]

467

489

-

PD604777

5

159

S=491 I=67 E=6.22337e-52

PD558306

468

517

S=222 I=86 E=2.8109e-19

PD642747

803

848

S=213 I=98 E=3.554e-18

PD351876

162

238

S=171 I=50 E=4.32508e-13

PDA1U4T6

767

802

S=158 I=92 E=1.80559e-11

PD642751

635

719

S=152 I=45 E=8.23133e-11

PD006990

243

297

S=127 I=45 E=7.92932e-08

PDA2K0B5

611

634

S=118 I=100 E=1.17291e-06

PD017552

725

766

S=106 I=43 E=3.57747e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Iayx1qun)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

6 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

21 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0kuFNo/XFF4834R_chr21900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0kuFNo/XFF4834R_chr21900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0kuFNo/XFF4834R_chr21900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0kuFNo/XFF4834R_chr21900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.