Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr18650tldDXFF4834R_chr18650probable peptidase TldD
  2. XFF4834R_chr18670tldEXFF4834R_chr18670probable peptidase TldE (PmbA)
  3. XFF4834R_chr22210XFF4834R_chr24170719_2568318_f1_XFF4834R-XFF4834R_chr22210XFF4834R_chr22210putative O-methyltransferase
  4. XFF4834R_chr26010XFF4834R_chr_3005234_3005890_f2_XFF4834R-XFF4834R_chr26010XFF4834R_chr26010putative HNH nuclease
  5. XFF4834R_chr42450XFF4834R_chr_4927858_4928139_f1_XFF4834R-XFF4834R_chr42450XFF4834R_chr42450putative toxin of the YafQ-DinJ toxin-antitoxin system

tldD XFF4834R_chr18650
XFF4834R_chr18640
XFF4834R_chr18640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2000
XFF4834R_chr_2000
ID tldD
AC XFF4834R_chr18650
LT XFF4834R_chr18650
OR XFF4834R_chr from 2135361 to 2136806 on strand +
DE probable peptidase TldD
IP Peptidase U62, modulator of DNA gyrase
CL 5.10 Defense/survival GO:0006952
EC
GO InterPro


Curated
PM
AN tldD is annotated predicted peptidase in GenProtEC (Putative modulator of DNA gyrase) 2 physiological roles in GenProtEC Information transfer --> Protein related --> Export, signal peptide cleavage Cell processes --> Defense/survival Microcin B17 (MccB17) is a peptide antibiotic produced by Escherichia coli strains carrying the pMccB17 plasmid. MccB17 is synthesized as a precursor containing an amino-terminal leader peptide that is cleaved during maturation. Maturation requires the product of the chromosomal tldE (pmbA) gene. Mature microcin is exported across the cytoplasmic membrane by a dedicated ABC transporter. In sensitive cells, MccB17 targets the essential topoisomerase II DNA gyrase. Independently, tldE as well as tldD mutants were isolated as being resistant to CcdB, another natural poison of gyrase encoded by the ccd poison-antidote system of plasmid F. This led to the idea that TldD and TldE could regulate gyrase function. We present in vivo evidence supporting the hypothesis that TldD and TldE have proteolytic activity. We show that in bacterial mutants devoid of either TldD or TldE activity, the MccB17 precursor accumulates and is not exported. Similarly, in the ccd system, we found that TldD and TldE are involved in CcdA and CcdA41 antidote degradation rather than being involved in the CcdB resistance mechanism. Interestingly, sequence database comparisons revealed that these two proteins have homologues in eubacteria and archaebacteria, suggesting a broader physiological role.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120307)
MW 50710.6 Da
SQ 481 aa
 
........10........20........30........40........50
| | | | |
MTDNALTLAETRLLLPSGLDAGHLDRTFGALLGPGIDFGDLYFQHSRRES
WSVEDGIVKDGAHSIEQGVGVRAIAGEKTGFAYSDDIHRDALLEAAQSAR
AISREGGAQSTRSLVRGNGRALYPATDTIDDMDSATKVDLLRRIDQFLRA
ADPRVKQVMVSLSGGVDTVLIARSDGALAADVRPLVRLNVQVIVEQGGRR
ESGYSGGGGRYGYADLFADGRPEGFAREALRQALVNLDAIPAPAGVMPVV
LGPGWPGVLLHEAVGHGLEGDFNRKGTSVYAGRIGERVASPGVTIVDDGT
LDGRRGSLNIDDEGTPSQCTTLIEDGVLVGYMQDSHNARLMGVAPTGNGR
RESFAHLTMPRMTNTYMRAGQHDPEEMIRSVKKGIYAVNFGGGQVDITSG
KYVFSATEAYLIEDGKVTAPVKGATLIGNGPETMQKVRMIGNDLALDEGV
GVCGKDGQSVPVGVGQPSLLIDGITVGGTQA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr01320 lcl|XFF4834R_chr_0163473_0165101_f3_XFF4834R-XFF4834R_chr01320

236

479

S=192 I=30 E=1.29996e-16

XFF4834R

XFF4834R_chr01330 lcl|XFF4834R_chr01440794_0167428_f2_XFF4834R-XFF4834R_chr01330

229

479

S=179 I=28 E=5.66872e-15

XFF4834R

XFF4834R_chr18670 lcl|pmbA-XFF4834R_chr18670

66

444

S=152 I=25 E=1.09691e-11

predicted peptidase required for the maturation and secretion of the antibiotic peptide MccB17

XFF4834R

NP_643076.1 lcl|tldD-XAC2767

1

481

S=2367 I=96 E=0

TldD protein

XFF4834R

YP_364654.1 lcl|tldD-XCV2923

1

481

S=2365 I=96 E=0

putative modulator of DNA gyrase TldD

XFF4834R

NP_637954.1 lcl|tldD-XCC2606

1

481

S=2294 I=92 E=0

TldD protein

XFF4834R

lcl|tldD-XALc_2458

1

479

S=2083 I=83 E=0

putative modulator of dna gyrase protein

XFF4834R

NP_635490.1 lcl|tldD-XCC0095

219

479

S=199 I=30 E=7.0313e-17

TldD protein

XFF4834R

NP_640478.1 lcl|tldD-XAC0122

244

479

S=188 I=29 E=1.59443e-15

TldD protein

XFF4834R

YP_361824.1 lcl|XCV0093

236

479

S=187 I=30 E=2.05312e-15

putative modulator of DNA gyrase

XFF4834R

NP_635489.1 lcl|tldD-XCC0094

229

479

S=184 I=28 E=5.79439e-15

TldD protein

XFF4834R

YP_361823.1 lcl|XCV0092

229

479

S=178 I=28 E=2.39998e-14

putative modulator of DNA gyrase

XFF4834R

NP_640477.1 lcl|tldD-XAC0121

229

479

S=178 I=28 E=2.39998e-14

TldD protein

pubmed

5

479

S=1445 I=59 E=3.20084e-166

Protein tldD

Pubmed 8604133

 

prodomImg

pubmed

5

479

S=1430 I=59 E=2.29431e-164

Putative DNA gyrase modulator

Pubmed 16177365

 

prodomImg

pubmed

23

481

S=1250 I=54 E=1.39449e-142

Peptidase U62

Pubmed 18459973

 

prodomImg

pubmed

35

481

S=1182 I=54 E=2.68713e-134

TldD

Pubmed 8825087

 

prodomImg

pubmed

373

447

S=305 I=79 E=4.89754e-28

Hypothetical tldD protein

Pubmed 11587856

 

prodomImg

pubmed

50

446

S=299 I=27 E=2.15617e-27

Peptidase U62

Pubmed 18459973

 

prodomImg

pubmed

258

480

S=229 I=31 E=6.53815e-19

CalR6

Pubmed 12183629

 

prodomImg

pubmed

222

480

S=170 I=29 E=9.45663e-12

LmbIH

Pubmed 11816970

 

prodomImg

pubmed

222

454

S=128 I=24 E=1.18133e-06

Protein pmbA ; Cytoplasm

Pubmed 2082149,8604133

 

prodomImg

pubmed

222

328

S=117 I=38 E=2.43382e-05

LmbI protein

Pubmed 8577249

 

prodomImg

Iprscan IPR002510 [PF01523]

37

331

Peptidase U62, modulator of DNA gyrase

Iprscan [seg]

197

213

-

PD002926

26

476

S=851 I=43 E=1.65495e-95

PD040622

102

190

S=245 I=57 E=3.75618e-22

PDA1F8S5

232

275

S=222 I=93 E=2.57537e-19

PD040623

32

92

S=207 I=65 E=1.61968e-17

PDA1V2N8

1

33

S=160 I=100 E=7.03939e-12

PDA233U0

386

417

S=146 I=81 E=3.52919e-10

PDA1S981

386

439

S=139 I=54 E=2.445e-09

PDA4Z3O2

348

446

S=137 I=29 E=4.58045e-09

PDA1T9R0

430

454

S=115 I=88 E=1.99573e-06

PD455129

283

385

S=115 I=34 E=2.17754e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UTwmRR34)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

17 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
tldE XFF4834R_chr18670
XFF4834R_chr18660
XFF4834R_chr18660
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18680
XFF4834R_chr18680
ID tldE
AC XFF4834R_chr18670
LT XFF4834R_chr18670
OR XFF4834R_chr from 2137789 to 2139156 on strand +
DE probable peptidase TldE (PmbA)
IP Peptidase U62, modulator of DNA gyrase
CL 5.10 Defense/survival GO:0006952
EC
GO InterPro


Curated
PM
AN tldE (pmbA) is annotated predicted peptidase required for the maturation and secretion of the antibiotic peptide MccB17 (Putative modulator of DNA gyrase) in GenProtEC 2 Physiological roles in GenProtEC Information transfer --> Protein related --> Export, signal peptide cleavage Cell processes --> Defense/survival Cell processes --> Protection --> Cell killing Location of gene products --> Cytoplasm Microcin B17 (MccB17) is a peptide antibiotic produced by Escherichia coli strains carrying the pMccB17 plasmid. MccB17 is synthesized as a precursor containing an amino-terminal leader peptide that is cleaved during maturation. Maturation requires the product of the chromosomal tldE (pmbA) gene. Mature microcin is exported across the cytoplasmic membrane by a dedicated ABC transporter. In sensitive cells, MccB17 targets the essential topoisomerase II DNA gyrase. Independently, tldE as well as tldD mutants were isolated as being resistant to CcdB, another natural poison of gyrase encoded by the ccd poison-antidote system of plasmid F. This led to the idea that TldD and TldE could regulate gyrase function. We present in vivo evidence supporting the hypothesis that TldD and TldE have proteolytic activity. We show that in bacterial mutants devoid of either TldD or TldE activity, the MccB17 precursor accumulates and is not exported. Similarly, in the ccd system, we found that TldD and TldE are involved in CcdA and CcdA41 antidote degradation rather than being involved in the CcdB resistance mechanism. Interestingly, sequence database comparisons revealed that these two proteins have homologues in eubacteria and archaebacteria, suggesting a broader physiological role.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120307)
MW 48010.1 Da
SQ 455 aa
 
........10........20........30........40........50
| | | | |
MNALSSEIRVTDDSLQRLDALTDISQRLLERARAAGATQAEVSCSEERGL
DVNVRLGDVETVESTRDRGIAVTVYFGKRKGSASTADLQDSSLESTVAQA
CAIARFTEDDVAAGLADPELMAREFPELDSWHPWALDADTAVDLALACET
AGRDADARISNSDGASASTGLSLSVYANSHGFIGRERGTHHSISCALIAG
QGDGMQRDGWYSSALAREDLEAPDAIGRHAAERTVARLQPRSLPTGQLPV
LFAPEVARSLVGHLLGAVSGGALYRRASFLLDSVGSKLFPDWFNIEELPH
LRRGLRSAAFDGEGVATRRSALITDGVLQRYVLGSYSARKLGLQTTANAG
GVHNLQVTANAGDLASMIAGMSRGLLVTELMGNGVNPVTGDYSRGAGGFW
IENGVIAYPVDGLTVAGNLRDMFAGIEAVGSDVDPRSHVKIGSVLINRMT
VAGDS
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr01340 lcl|XFF4834R_chr_0167443_0168777_f1_XFF4834R-XFF4834R_chr01340

53

433

S=176 I=24 E=1.34933e-14

XFF4834R

XFF4834R_chr18650 lcl|tldD-XFF4834R_chr18650

223

433

S=145 I=27 E=6.75355e-11

predicted peptidase

XFF4834R

NP_643074.1 lcl|pmbA-XAC2765

1

455

S=2264 I=96 E=0

PmbA protein

XFF4834R

YP_364651.1 lcl|pmbA-XCV2920

1

455

S=2264 I=96 E=0

putative modulator of DNA gyrase; peptidase U62 protein PmbA

XFF4834R

NP_637952.1 lcl|pmbA-XCC2604

1

455

S=2175 I=92 E=0

PmbA protein

XFF4834R

lcl|pmbA-XALc_2456

1

453

S=1765 I=76 E=0

putative modulator of dna gyrase protein

XFF4834R

NP_640476.1 lcl|tldD-XAC0120

50

433

S=184 I=25 E=4.70263e-15

TldD protein

XFF4834R

NP_635488.1 lcl|tldD-XCC0093

50

433

S=182 I=24 E=8.65757e-15

TldD protein

XFF4834R

YP_361822.1 lcl|XCV0091

50

433

S=181 I=25 E=1.13443e-14

putative modulator of DNA gyrase

XFF4834R

NP_643076.1 lcl|tldD-XAC2767

223

433

S=145 I=27 E=2.77547e-10

TldD protein

XFF4834R

YP_364654.1 lcl|tldD-XCV2923

223

433

S=144 I=27 E=2.97597e-10

putative modulator of DNA gyrase TldD

XFF4834R

NP_637954.1 lcl|tldD-XCC2606

223

433

S=143 I=26 E=3.93366e-10

TldD protein

pubmed

40

453

S=1012 I=47 E=9.34881e-114

Protein pmbA ; Cytoplasm

Pubmed 2082149,8604133

 

prodomImg

pubmed

22

453

S=843 I=41 E=2.48407e-93

Peptidase U62

Pubmed 18459973

 

prodomImg

pubmed

75

166

S=146 I=39 E=8.12749e-09

Putative antibiotic maturation factor

Pubmed 10658663

 

prodomImg

pubmed

228

433

S=131 I=27 E=5.48073e-07

Peptidase U62

Pubmed 18459973

 

prodomImg

pubmed

302

433

S=118 I=30 E=1.71596e-05

TldD

Pubmed 8825087

 

prodomImg

Iprscan IPR002510 [PF01523]

38

331

Peptidase U62, modulator of DNA gyrase

Iprscan [seg]

135

147

-

PD002926

27

452

S=828 I=44 E=8.025e-93

PDA1F9E7

77

133

S=151 I=55 E=8.32039e-11

PDA1J7N6

231

280

S=136 I=53 E=6.67968e-09

PDA1F9Z8

28

75

S=133 I=58 E=1.25137e-08

PD574559

285

410

S=132 I=34 E=1.77355e-08

PDA1T8C5

1

27

S=125 I=96 E=1.37617e-07

PDA01060

149

233

S=120 I=36 E=5.00122e-07

PDA1G2T0

191

231

S=120 I=56 E=5.90227e-07

PD820807

148

185

S=109 I=53 E=1.05768e-05

PDA3O973

419

454

S=107 I=56 E=1.91353e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one woqDZ4zu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

13 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18670.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18670.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr18670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr24170719_2568318_f1_XFF4834R-XFF4834R_chr22210 XFF4834R_chr22210
XFF4834R_chr22200
XFF4834R_chr22200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2366
XFF4834R_chr_2366
ID XFF4834R_chr24170719_2568318_f1_XFF4834R-XFF4834R_chr22210
AC XFF4834R_chr22210
LT XFF4834R_chr22210
OR XFF4834R_chr from 2567719 to 2568318 on strand +
DE putative O-methyltransferase
IP O-methyltransferase, family 3
CL 5.10 Defense/survival GO:0006952
EC
GO InterPro
Molecular Function: O-methyltransferase activity (GO:0008171)

Curated
PM
AN O-methyltransferases : the family includes also bacterial O-methyltransferases that may be involved in antibiotic production.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 21357 Da
SQ 199 aa
 
........10........20........30........40........50
| | | | |
MRTLQDLKGQLSRFGADNDAVETARGKRMLNITPETGELLALLALLVHAT
QARQVVEVGTSNGYSTLWLAEAVIAVGGHVITLEHAEDKAALAAANFVRA
GLQAHITQVPGDAGAWLETADDASVDLLFLDADRSAYTRWWPQLRRVLKP
GAGLIVVDNATSHATEMADFTQAVRADMSFRCSEVSVGNGQFMAVRVAD
Show or not Domain decomposition
 
XFF4834R

NP_642438.1 lcl|mdmC-XAC2121

1

199

S=838 I=83 E=1.01165e-94

O-methyltransferase

pubmed

56

195

S=238 I=38 E=1.49023e-20

O-methyl transferase

Pubmed 11160120

 

prodomImg

pubmed

51

177

S=184 I=36 E=5.983e-14

Putative O-methyltransferase

Pubmed 16725283

 

prodomImg

pubmed

22

159

S=171 I=38 E=1.97382e-12

O-methyltransferase

Pubmed 16707707

 

prodomImg

pubmed

47

169

S=168 I=42 E=4.55839e-12

O-methyltransferase

Pubmed 12060743

 

prodomImg

pubmed

26

159

S=167 I=33 E=7.29933e-12

O-methyltransferase mdmC EC=2.1.1.- ; Antibiotic biosynthesis Metal-binding S-adenosyl-L-methionine

Pubmed 1629172

 

prodomImg

pubmed

23

159

S=158 I=35 E=7.68492e-11

O-methyl transferase

Pubmed 16707708,18708355

 

prodomImg

pubmed

47

159

S=152 I=38 E=4.55079e-10

Methoxymalonate biosynthesis protein

Pubmed 16207901

 

prodomImg

pubmed

28

159

S=149 I=35 E=1.0328e-09

Putative O-methyltransferase

Pubmed 7551044,8936303

 

prodomImg

pubmed

49

160

S=142 I=36 E=7.34483e-09

3-dehydroquinate synthase/O-methyltransferase fusion

Pubmed 16675503

 

prodomImg

pubmed

31

159

S=142 I=35 E=7.40915e-09

FkbG

Pubmed 10863099

 

prodomImg

sp_Pdown

sp|Q00719|MDMC_STRMY

26

159

S=167 I=33 E=5.05926e-12

O-methyltransferase mdmC EC=2.1.1.- ; Antibiotic biosynthesis Metal-binding S-adenosyl-L-methionine

Iprscan [G3DSA:3.40.50.150]

22

164

-

Iprscan IPR002935 [PF01596]

17

197

O-methyltransferase, family 3

Iprscan [seg]

39

46

-

Iprscan [seg]

90

95

-

PD002981

30

180

S=188 I=30 E=2.63895e-15

PD245993

109

159

S=117 I=53 E=1.06698e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one cJg8w9LJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr22210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr22210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr22210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr22210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_3005234_3005890_f2_XFF4834R-XFF4834R_chr26010 XFF4834R_chr26010
XFF4834R_chr26000
XFF4834R_chr26000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26020
XFF4834R_chr26020
ID XFF4834R_chr_3005234_3005890_f2_XFF4834R-XFF4834R_chr26010
AC XFF4834R_chr26010
LT XFF4834R_chr26010
OR XFF4834R_chr from 3005234 to 3005890 on strand +
DE putative HNH nuclease
IP HNH nuclease
CL 5.10 Defense/survival GO:0006952
EC
GO InterPro
Molecular Function: nucleic acid binding (GO:0003676)
Molecular Function: endonuclease activity (GO:0004519)

Curated
PM
AN
CC COG: [V] Defense mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100629)
MW 24230.5 Da
SQ 218 aa
 
........10........20........30........40........50
| | | | |
METDTHVRDVIVPGGSYAPDAGSAVAAIHQLPTLRLLSLDAHGRVLDWIN
WQDAACLYARDAVSWTLGEPCMQIHGGISRLTGERSALELHPIIAARGHA
RSRALDPTPTLSNTALFARDSQLCMYCGQHFSRPHLTRDHVMPVSKGGRD
SWENVVTACFQCNSRKANRTPQQAHMPLLAVPYRPSWIEHLILSNRNILS
DQMAFLRAQLPKRSKLSL
XFF4834R

NP_642878.2 lcl|XAC2564-XAC2564

1

218

S=1152 I=99 E=1.09926e-132

hypothetical protein

XFF4834R

YP_364494.1 lcl|XCV2763

1

218

S=1143 I=99 E=1.10796e-131

HNH endonuclease family protein

XFF4834R

NP_637786.2 lcl|XCC2433

1

218

S=1090 I=94 E=3.48471e-125

hypothetical protein

XFF4834R

lcl|XALc_1083

1

217

S=923 I=79 E=4.85706e-105

hypothetical protein

pubmed

110

178

S=202 I=54 E=5.49142e-16

HNH endonuclease

Pubmed 16368872

 

prodomImg

pubmed

111

185

S=184 I=47 E=8.40423e-14

HNH endonuclease

Pubmed 16368872

 

prodomImg

pubmed

116

170

S=115 I=35 E=1.48425e-05

Putative uncharacterized protein

Pubmed 7514146,8917075

 

prodomImg

pubmed

116

173

S=110 I=45 E=7.38283e-05

HNH endonuclease

Pubmed 17383677

 

prodomImg

pubmed

116

168

S=109 I=46 E=8.48803e-05

Putative uncharacterized protein

Pubmed 11976141

 

prodomImg

Iprscan IPR002711 [PF01844]

122

169

HNH endonuclease

Iprscan IPR003615 [SM00507]

111

164

HNH nuclease

PD284088

34

134

S=331 I=61 E=1.35919e-32

PD860184

168

216

S=184 I=69 E=7.73039e-15

PDA2I8A5

1

35

S=159 I=89 E=7.38211e-12

PDA5R9F5

103

194

S=126 I=36 E=9.06998e-08

PD644509

10

35

S=122 I=92 E=2.76872e-07

PD077169

136

166

S=101 I=59 E=8.81371e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Kk7aPKcL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr26010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr26010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr26010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr26010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4927858_4928139_f1_XFF4834R-XFF4834R_chr42450 XFF4834R_chr42450
XFF4834R_chr42440
XFF4834R_chr42440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42460
XFF4834R_chr42460
ID XFF4834R_chr_4927858_4928139_f1_XFF4834R-XFF4834R_chr42450
AC XFF4834R_chr42450
LT XFF4834R_chr42450
OR XFF4834R_chr from 4927858 to 4928139 on strand +
DE putative toxin of the YafQ-DinJ toxin-antitoxin system
IP Plasmid stabilization system; Addiction module toxin, RelE/StbE
CL 5.10 Defense/survival GO:0006952
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100916)
MW 10678.9 Da
SQ 93 aa
 
........10........20........30........40........50
| | | | |
MRTIDRSSAFKRDYKREAKGQHRATLDDAIKPVLVALATDQPPDARYRDH
DLSGDWAGYRECHIKPDLLLIYRKSDPDTLRLARLGSHSELFG
pubmed

1

91

S=339 I=71 E=2.12995e-33

Plasmid stabilization system Putative uncharacterized protein

Pubmed 15186344

 

prodomImg

pubmed

1

91

S=339 I=71 E=2.12995e-33

Hypothetical Xf2080 protein ; Plasmid

Pubmed 14600226

 

prodomImg

pubmed

1

91

S=339 I=71 E=2.12995e-33

Putative uncharacterized protein ; Plasmid

Pubmed 15580337,16517619

 

prodomImg

pubmed

23

93

S=324 I=90 E=1.66579e-31

Putative addiction module toxin ; Plasmid

Pubmed 18227089

 

prodomImg

pubmed

23

93

S=322 I=90 E=2.32011e-31

Putative uncharacterized protein ; Plasmid

Pubmed 17261525

 

prodomImg

pubmed

23

93

S=317 I=89 E=1.00379e-30

Putative uncharacterized protein

Pubmed 15574953

 

prodomImg

pubmed

23

93

S=317 I=89 E=1.00379e-30

Putative uncharacterized protein ; Plasmid

Pubmed 17101677

 

prodomImg

pubmed

1

92

S=182 I=43 E=2.24786e-14

Putative uncharacterized protein orf4H ; Plasmid

Pubmed 11976306

 

prodomImg

pubmed

1

92

S=182 I=43 E=2.36858e-14

Putative uncharacterized protein orf5F ; Plasmid

Pubmed 11976306

 

prodomImg

pubmed

1

92

S=179 I=42 E=6.18022e-14

R3 ; Plasmid

Pubmed 7806390,17921278

 

prodomImg

sp_Pdown

sp|Q47149|YAFQ_ECOLI

2

93

S=154 I=38 E=3.56366e-11

Uncharacterized protein yafQ

sp_Pdown

sp|P44041|Y711_HAEIN

4

90

S=136 I=34 E=5.31313e-09

Uncharacterized protein HI0711

Iprscan IPR007712 [PF05016]

4

92

Plasmid stabilisation system

Iprscan IPR012753 [TIGR02385]

3

92

Addiction module toxin, RelE/StbE

PDA6M5N9

10

59

S=152 I=66 E=5.53836e-11

PD423708

60

93

S=128 I=74 E=4.84725e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xBSi7HHA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr42450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr42450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr42450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhIwxgK/XFF4834R_chr42450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.