Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr16590XFF4834R_chr16590putative PTS system, enzyme I
  2. XFF4834R_chr16600XFF4834R_chr17860690_1916959_r3_XFF4834R-XFF4834R_chr16600XFF4834R_chr16600putative PTS system, HPr phosphocarrier protein
  3. XFF4834R_chr16610XFF4834R_chr17860952_1917272_r2_XFF4834R-XFF4834R_chr16610XFF4834R_chr16610putative PTS system, mannose/fructose-specific component IIA
  4. XFF4834R_chr16650XFF4834R_chr17890674_1920114_r1_XFF4834R-XFF4834R_chr16650XFF4834R_chr16650putative PTS system, fructose/mannitol-specific component IIA
  5. XFF4834R_chr24970fruBXFF4834R_chr24970PTS fructose porter, probable
  6. XFF4834R_chr24990fruAXFF4834R_chr24990PTS fructose porter IIBC component, probable

XFF4834R_chr16590
XFF4834R_chr16580
XFF4834R_chr16580
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16600
XFF4834R_chr16600
ID
AC XFF4834R_chr16590
LT XFF4834R_chr16590
OR XFF4834R_chr from 1914901 to 1916631 on strand -
DE putative PTS system, enzyme I
IP PEP-utilising enzyme; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL 4.4.A Phosphotransferase Systems (PEP-dependent PTS) GO:0009401
EC
GO InterPro
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Biological Process: phosphorylation (GO:0016310)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: phosphoenolpyruvate-protein phosphotransferase activity (GO:0008965)
transferring phosphorus-containing groups (GO:0016772)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 63365 Da
SQ 576 aa
 
........10........20........30........40........50
| | | | |
MSLRLRGHGAARGNALGRARVRQSHTLEVAEQRVPANQVETQLQRLHAAI
ASARVEMQQLRDRLHGALAREVGEFLELHALLLDDPELLQGLDELIRTHR
YSADYALRVQRDRLAAVFDGMEDAYLKSRMDDLDHVIGRIHAFLHKRVPD
LKGVAGEILVCDNVAPSELAQLQAQGVVGIVTTAGSTLSHSAILARSLHL
PLVVGVSDALQRIEDGDVLIVDAGSGQVIVDPKPEHLRDYRERLRALAKE
QRELGRLRSKPTRTRDNVDITLLANAESLEDVANAHALGASGLGLYRTEF
LFLQRNELPDEDEQFHTYRDTVLGMSGRPVTIRTLDLGADKADRTGLTLS
DEDNPALGLRGVRLSLARPAVAQAQLRAILRASGYGPVRILVPMVSGREE
ILQLRKQLKKLTAQLRAEGHEIAEHLPLGAMIEVPAAALALDCFIDDIDF
LSIGTNDLVQYLLAVDRNNEALGELYSPLHPAVLRLIAQVIATGRAYGKP
VAVCGEIAGDPRFVPMLLALGLTEFSLHPATLLEVRRAVRDTHLGELRVH
GEKLLRARDRKGIEKWLTGHAQGLLR
XFF4834R

XFF4834R_chr24970 lcl|XFF4834R_chr27350581_2889097_f2_XFF4834R-XFF4834R_chr24970

158

555

S=623 I=40 E=1.00273e-68

XFF4834R

XFF4834R_chr21470 lcl|pps-XFF4834R_chr21470

155

535

S=244 I=27 E=8.46649e-23

phosphoenolpyruvate synthase

XFF4834R

NP_643288.1 lcl|ptsI-XAC2979

23

576

S=2697 I=95 E=0

phosphotransferase system enzyme I

XFF4834R

YP_364856.1 lcl|ptsI-XCV3125

23

576

S=2695 I=95 E=0

enzyme I of the phosphotransferase system

XFF4834R

NP_638157.1 lcl|ptsI-XCC2809

23

575

S=2588 I=92 E=0

phosphotransferase system enzyme I

XFF4834R

lcl|XALc_2146

25

567

S=2051 I=75 E=0

putative phosphotransferase system (pts), enzymeIprotein

XFF4834R

NP_637724.1 lcl|fruB-XCC2370

158

557

S=637 I=41 E=8.1398e-70

multiphosphoryl transfer protein

XFF4834R

NP_642816.1 lcl|fruB-XAC2501

158

555

S=617 I=40 E=2.23421e-67

multiphosphoryl transfer protein

XFF4834R

YP_364410.1 lcl|fruB-XCV2679

158

555

S=615 I=41 E=3.3658e-67

multiphosphoryl transfer protein FruB

XFF4834R

YP_363933.1 lcl|ppsA-XCV2202

155

535

S=249 I=28 E=9.31747e-23

phosphoenolpyruvate synthase

XFF4834R

NP_637522.1 lcl|ppsA-XCC2166

155

534

S=247 I=28 E=1.41596e-22

phosphoenolpyruvate synthase

XFF4834R

NP_642367.1 lcl|ppsA-XAC2041

352

535

S=212 I=31 E=2.46568e-18

phosphoenolpyruvate synthase

XFF4834R

lcl|ppsA-XALc_1645

329

535

S=205 I=30 E=1.6641e-17

probable phosphoenolpyruvate synthase protein

XFF4834R

lcl|ppsA-XALc_1645

156

226

S=101 I=35 E=8.1238e-05

probable phosphoenolpyruvate synthase protein

pubmed

32

567

S=944 I=38 E=2.22945e-105

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Magnesium Metal-binding Transferase

Pubmed 15670601

 

prodomImg

pubmed

30

536

S=926 I=39 E=3.35303e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7670643

 

prodomImg

pubmed

96

559

S=926 I=46 E=3.78833e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1653223

 

prodomImg

pubmed

96

575

S=925 I=39 E=4.20617e-103

Phosphoenolpyruvate-protein phosphotransferase ; Kinase Magnesium Metal-binding

Pubmed 17693723

 

prodomImg

pubmed

27

539

S=902 I=42 E=2.57486e-100

Putative phosphoenolpyruvate-protein phosphotransferase ; Kinase Magnesium Metal-binding

Pubmed 18328084

 

prodomImg

sp_Pdown

sp|Q9K8D3|PT1_BACHD

32

555

S=968 I=37 E=1.81067e-108

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

sp_Pdown

sp|P42014|PT1_BACST

30

536

S=926 I=39 E=2.28172e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

sp_Pdown

sp|P23536|PT1_RALEH

96

559

S=926 I=46 E=2.57794e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

sp_Pdown

sp|O83018|PT1_BACSI

30

536

S=923 I=39 E=5.74953e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

sp_Pdown

sp|O69251|PT1_BACME

28

555

S=898 I=36 E=6.2033e-100

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Iprscan [coil]

36

71

-

Iprscan [coil]

237

258

-

Iprscan [coil]

394

422

-

Iprscan IPR006318 [PR01736]

294

313

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

449

464

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

466

481

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

502

514

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR008731 [G3DSA:1.10.274.10]

24

144

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [G3DSA:3.20.20.60]

251

575

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan [PTHR22931:SF10]

3

556

-

Iprscan [PTHR22931]

3

556

-

Iprscan IPR000121 [PF02896]

252

542

PEP-utilising enzyme

Iprscan IPR008731 [PF05524]

5

129

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR008279 [PF00391]

155

226

PEP-utilising enzyme, mobile domain

Iprscan IPR006318 [TIGR01417]

5

568

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR000121 [PS00742]

449

467

PEP-utilising enzyme

Iprscan [seg]

3

22

-

Iprscan [seg]

76

95

-

PD000940

274

529

S=432 I=40 E=8.6122e-45

PD552666

158

241

S=213 I=48 E=2.66381e-18

PD592409

158

410

S=194 I=24 E=5.53152e-16

PD267318

530

576

S=168 I=68 E=8.68269e-13

PD507570

468

526

S=161 I=53 E=5.46521e-12

PDA0X3V0

263

362

S=150 I=36 E=1.21788e-10

PD715246

136

228

S=142 I=40 E=1.17515e-09

PD860808

418

467

S=140 I=59 E=2.0177e-09

PD003552

156

228

S=130 I=44 E=3.1176e-08

PDA5N345

157

288

S=130 I=29 E=3.34281e-08

Iprscan IPR015813 [SSF51621]

246

547

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

128

250

PEP-utilising enzyme, mobile domain

Iprscan IPR008731 [SSF47831]

25

147

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UTAAwG08)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

107 hits
swiss-prot

Swiss-Prot ncbi-blastp

86 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

21 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16590.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16590.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17860690_1916959_r3_XFF4834R-XFF4834R_chr16600 XFF4834R_chr16600
XFF4834R_chr16590
XFF4834R_chr16590
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16610
XFF4834R_chr16610
ID XFF4834R_chr17860690_1916959_r3_XFF4834R-XFF4834R_chr16600
AC XFF4834R_chr16600
LT XFF4834R_chr16600
OR XFF4834R_chr from 1916690 to 1916959 on strand -
DE putative PTS system, HPr phosphocarrier protein
IP Phosphotransferase system, phosphocarrier HPr protein-like
CL 4.4.A Phosphotransferase Systems (PEP-dependent PTS) GO:0009401
EC
GO InterPro
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Biological Process: transport (GO:0006810)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 9674.9 Da
SQ 89 aa
 
........10........20........30........40........50
| | | | |
MLERELIVSNRLGLHARATAKLVQTLSSYRSNATLAAKGREVNAKSIMGV
MLLAAGQGTSVVVRLDGEDEAEALQALVDLFERRFDEDS
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr24970 lcl|XFF4834R_chr27350581_2889097_f2_XFF4834R-XFF4834R_chr24970

5

77

S=95 I=32 E=6.60896e-06

XFF4834R

YP_364855.1 lcl|ptsH-XCV3124

1

89

S=444 I=100 E=8.92904e-48

phosphotransferase system HPr enzyme

XFF4834R

NP_643287.1 lcl|ptsH-XAC2978

1

89

S=444 I=100 E=8.92904e-48

phosphotransferase system HPr enzyme

XFF4834R

NP_638156.1 lcl|ptsH-XCC2808

1

89

S=433 I=97 E=2.36881e-46

phosphotransferase system HPr enzyme

XFF4834R

lcl|XALc_2145

1

89

S=391 I=85 E=2.73582e-41

putative phosphotransferase system (pts), hpr enzyme protein

XFF4834R

NP_642816.1 lcl|fruB-XAC2501

5

77

S=95 I=32 E=2.04379e-05

multiphosphoryl transfer protein

XFF4834R

YP_364410.1 lcl|fruB-XCV2679

5

77

S=95 I=32 E=2.15355e-05

multiphosphoryl transfer protein FruB

pubmed

1

87

S=229 I=52 E=5.47834e-20

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 1653223

 

prodomImg

pubmed

1

87

S=201 I=57 E=1.34144e-16

Putative phosphocarrier protein ; Cytoplasm Kinase Phosphotransferase system

Pubmed 18328084

 

prodomImg

pubmed

1

84

S=189 I=44 E=3.91695e-15

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphoprotein Phosphotransferase system Sugar transport Transcription regulation

Pubmed 3098288

 

prodomImg

pubmed

1

84

S=175 I=39 E=1.92982e-13

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphoprotein Phosphotransferase system Sugar transport Transcription regulation

Pubmed 1901791,1551842

 

prodomImg

pubmed

1

84

S=173 I=37 E=3.25617e-13

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphoprotein Phosphotransferase system Sugar transport

Pubmed 10714994

 

prodomImg

sp_Pdown

sp|Q9PDH6|PTHP_XYLFA

1

89

S=350 I=74 E=6.74221e-35

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphoprotein Phosphotransferase system Sugar transport

sp_Pdown

sp|Q87DQ0|PTHP_XYLFT

1

89

S=345 I=73 E=2.62723e-34

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphoprotein Phosphotransferase system Sugar transport

sp_Pdown

sp|P23537|PTHP_RALEH

1

87

S=229 I=52 E=3.40253e-20

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

sp_Pdown

sp|P65877|PTHP_NEIMB

1

87

S=206 I=47 E=2.02913e-17

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphoprotein Phosphotransferase system Sugar transport

sp_Pdown

sp|P65876|PTHP_NEIMA

1

87

S=206 I=47 E=2.02913e-17

Phosphocarrier protein HPr EC=2.7.11.- ; Cytoplasm Kinase Phosphoprotein Phosphotransferase system Sugar transport

Iprscan IPR005698 [PR00107]

13

29

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

38

53

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

53

70

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR000032 [G3DSA:3.30.1340.10]

1

88

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR005698 [PF00381]

1

83

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [TIGR01003]

1

82

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR001020 [PS00369]

13

20

Phosphotransferase system, HPr histidine phosphorylation site

Iprscan IPR002114 [PS00589]

39

54

Phosphotransferase system, HPr serine phosphorylation site

Iprscan IPR000032 [PS51350]

1

88

Phosphotransferase system, phosphocarrier HPr protein-like

PD002238

9

79

S=201 I=53 E=5.89717e-17

PDA7R7J5

2

74

S=140 I=38 E=1.74348e-09

PDA37786

6

87

S=133 I=33 E=1.187e-08

PDA4B8N1

2

87

S=125 I=30 E=9.53727e-08

Iprscan IPR000032 [SSF55594]

1

88

Phosphotransferase system, phosphocarrier HPr protein-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8OAbhW6B)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

66 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16600.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16600.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17860952_1917272_r2_XFF4834R-XFF4834R_chr16610 XFF4834R_chr16610
XFF4834R_chr16600
XFF4834R_chr16600
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16620
XFF4834R_chr16620
ID XFF4834R_chr17860952_1917272_r2_XFF4834R-XFF4834R_chr16610
AC XFF4834R_chr16610
LT XFF4834R_chr16610
OR XFF4834R_chr from 1916952 to 1917344 on strand -
DE putative PTS system, mannose/fructose-specific component IIA
IP Phosphotransferase system, fructose subfamily IIA component
CL 4.4.A.6 The PTS Mannose-Fructose-Sorbose (Man) Family
EC
GO InterPro
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 13564.6 Da
SQ 130 aa
 
........10........20........30........40........50
| | | | |
MACGILLITHPGIGAALLNVATGLLRQLPLKTEAFDVPFDADLDALLPQA
SSAMRRVDSGDGVLVMTDLYGASPSNLANRLAKLGTPVRRVSALSLPMLL
RVMNYPEQGLQELPATAAAGTRNGAIIDDA
Show or not Domain decomposition
 
XFF4834R

YP_364854.1 lcl|XCV3123

1

130

S=654 I=100 E=7.93013e-73

putative enzyme II of the phosphotransferase system

XFF4834R

NP_643286.1 lcl|XAC2977-XAC2977

1

130

S=654 I=100 E=7.93013e-73

hypothetical protein

XFF4834R

NP_638155.1 lcl|XCC2807

1

130

S=620 I=94 E=1.04472e-68

hypothetical protein

XFF4834R

lcl|XALc_2144

1

130

S=578 I=86 E=1.36322e-63

putative phosphotransferase system (pts), mannose/fructose-specific component IIa protein

Iprscan [G3DSA:3.40.50.510]

2

126

-

Iprscan IPR004701 [PF03610]

4

104

Phosphotransferase system, fructose subfamily IIA component

Iprscan IPR004701 [PS51096]

2

125

Phosphotransferase system, fructose subfamily IIA component

Iprscan [SignalP-NN(euk)]

1

16

-

PDA1M0T1

1

62

S=283 I=89 E=7.49969e-27

Iprscan IPR004701 [SSF53062]

2

129

Phosphotransferase system, fructose subfamily IIA component

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6smuV5aq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16610.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16610.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17890674_1920114_r1_XFF4834R-XFF4834R_chr16650 XFF4834R_chr16650
XFF4834R_chr16640
XFF4834R_chr16640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16660
XFF4834R_chr16660
ID XFF4834R_chr17890674_1920114_r1_XFF4834R-XFF4834R_chr16650
AC XFF4834R_chr16650
LT XFF4834R_chr16650
OR XFF4834R_chr from 1919674 to 1920114 on strand -
DE putative PTS system, fructose/mannitol-specific component IIA
IP Phosphotransferase/anion transporter
CL 4.4.A.2 The PTS Fructose-Mannitol (Fru) Family
EC
GO InterPro
Biological Process: transport (GO:0006810)
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)

Curated
PM
AN
CC COG: [GT] Carbohydrate transport and metabolism;Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 15431.3 Da
SQ 146 aa
 
........10........20........30........40........50
| | | | |
MAAVRTLVSPAADRDTVLHAAADLLSCRQAGADELYANLCEREALGSTAI
GHGIAIPHGRCPNLTEPRGALLRLDTPVPFGGDEPVDLVFAMAVPAHYTH
QHLMLLSELAERFSDADFRQNLRAAPNADALMTLLADVPPAQASAA
XFF4834R

NP_643283.1 lcl|ptsN-XAC2974

1

146

S=725 I=97 E=3.11804e-81

nitrogen regulatory IIA protein

XFF4834R

YP_364851.1 lcl|XCV3120

1

146

S=724 I=97 E=3.71203e-81

putative nitrogen regulatory IIA protein (protein-N(pi)-phosphohistidine-sugar phosphotransferase)

XFF4834R

NP_638152.1 lcl|ptsN-XCC2804

1

146

S=650 I=86 E=3.58912e-72

nitrogen regulatory IIA protein

pubmed

5

142

S=242 I=41 E=3.26891e-21

(rpoN) ; Transferase

Pubmed 8113171

 

prodomImg

pubmed

5

138

S=231 I=40 E=6.44744e-20

Nitrogen regulatory IIA-like protein ; Transferase

Pubmed 11697147

 

prodomImg

pubmed

6

137

S=225 I=34 E=3.81799e-19

Nitrogen reguratory IIA protein ; Transferase

Pubmed 10760597

 

prodomImg

pubmed

35

144

S=212 I=41 E=1.20584e-17

Nitrogen regulatory protein EC=2.7.1.- ; Cytoplasm Kinase Transferase

Pubmed 1991712

 

prodomImg

pubmed

34

144

S=204 I=40 E=1.18401e-16

Phosphotransferase system enzyme II

Pubmed 17953590

 

prodomImg

sp_Pdown

sp|Q9HVV4|PTSN_PSEAE

5

142

S=242 I=41 E=2.39062e-21

Nitrogen regulatory protein EC=2.7.1.- ; Cytoplasm Kinase Transferase

sp_Pdown

sp|P30335|PTSN_BRAJA

35

144

S=212 I=41 E=8.36912e-18

Nitrogen regulatory protein EC=2.7.1.- ; Cytoplasm Kinase Transferase

sp_Pdown

sp|P69815|PTSN_SHIFL

35

137

S=200 I=41 E=2.66638e-16

Nitrogen regulatory protein EC=2.7.1.- ; Cytoplasm Kinase Transferase

sp_Pdown

sp|P69829|PTSN_ECOLI

35

137

S=200 I=41 E=2.66638e-16

Nitrogen regulatory protein EC=2.7.1.- ; Cytoplasm Kinase Transferase

sp_Pdown

sp|P17162|PTSN_KLEOX

25

137

S=197 I=38 E=6.05137e-16

Nitrogen regulatory protein EC=2.7.1.- ; Cytoplasm Kinase Transferase

Iprscan IPR002178 [G3DSA:3.40.930.10]

10

145

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan [PTHR22931:SF10]

34

116

-

Iprscan [PTHR22931]

34

116

-

Iprscan IPR002178 [PF00359]

10

136

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR002178 [PS00372]

43

59

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR002178 [PS51094]

1

138

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

PD692174

4

44

S=196 I=93 E=2.44501e-16

PD001689

32

129

S=191 I=43 E=1.14418e-15

PD653656

13

97

S=120 I=28 E=4.74874e-07

Iprscan IPR016152 [SSF55804]

6

137

Phosphotransferase/anion transporter

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kwlehAyg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

17 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr16650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
fruB XFF4834R_chr24970
XFF4834R_chr24960
XFF4834R_chr24960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24980
XFF4834R_chr24980
ID fruB
AC XFF4834R_chr24970
LT XFF4834R_chr24970
OR XFF4834R_chr from 2886581 to 2889097 on strand +
DE PTS fructose porter, probable
IP
CL 4.4.A Phosphotransferase Systems (PEP-dependent PTS) GO:0009401
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110111)
MW 88549.2 Da
SQ 838 aa
 
........10........20........30........40........50
| | | | |
MSSPSPAPVTPDLVRLRASARDKDDAIAQAAQLLVAAGCVATGYEASMRR
REGLANTFLGHGLAIPHGDGEDRHLVRRDGIAVLQLPDGVEWNPGQITRL
VVGIAAQSDTHITLLRRLTRLIQDPAQLEALFSTDDPNVIVAALTGDRAP
ETSTAPATDLAEAFEWTIAYPSGLHARPATRWAETARGFSARAQVRAGDQ
AADAKSLVGLLQLGLRAGDSITVSAEGSDAAELLKRLRAVMDSLTAQEKA
DAERAAQRRAVPVAGWTPPQAQPAIVGIGASPGVAIGIIHRLRAAQTEVA
DQPVGLGDGGAQLHEALTRTRQQLAAIQDDTQRRLGASDAAIFKAQAELL
NDTDLITRTCQLMVEGHGVAWSWHQAVEQIASGLAALGNPVLAGRAADLR
DVGRRVLAQLDPAAAGAGLTDLPEQPCILLASDLSPSDTANLDTARVLGL
ATAQGGPTSHTAILSRTLGLPALVAAGGQLLEIEDGVTAIIDGSSGRLYI
DPSEQDLDAARTHIAEQQAIREREAAQRALPAETTDGHHIDIGANVNLPD
QVAMALTQGAEGVGLMRTEFLFLESGRTPSEDEQHATYLAMAQALDGRPL
IVRALDIGGDKQVAHLELPHEENPFLGVRGARLLLRRPDLLEPQLRALYR
AAKDGARLSIMFPMITSVPELIALREICARIRADLDAPEVPIGIMIEVPA
AAAQADVLARHADFFSIGTNDLTQYVLAIDRQNPELAAEADSLHPAVLRM
ICSTIEGARKHDRWVGVCGGLAGDAFGASLLAGLGVQELSMTPNDIPAVK
ARLRGAALSQLQQLAEQALACETAEQVRALEAKREDKA
XFF4834R

XFF4834R_chr16590 lcl|ptsI-XFF4834R_chr16590

277

800

S=570 I=32 E=4.71709e-62

PEP-protein phosphotransferase of PTS system (enzyme I)

XFF4834R

XFF4834R_chr21470 lcl|pps-XFF4834R_chr21470

657

796

S=153 I=28 E=1.53338e-11

phosphoenolpyruvate synthase

XFF4834R

NP_642816.1 lcl|fruB-XAC2501

1

838

S=3542 I=87 E=0

multiphosphoryl transfer protein

XFF4834R

YP_364410.1 lcl|fruB-XCV2679

1

838

S=3485 I=85 E=0

multiphosphoryl transfer protein FruB

XFF4834R

NP_637724.1 lcl|fruB-XCC2370

1

838

S=3396 I=83 E=0

multiphosphoryl transfer protein

XFF4834R

NP_643288.1 lcl|ptsI-XAC2979

277

800

S=576 I=32 E=3.16806e-62

phosphotransferase system enzyme I

XFF4834R

YP_364856.1 lcl|ptsI-XCV3125

277

800

S=570 I=32 E=1.52182e-61

enzyme I of the phosphotransferase system

XFF4834R

NP_638157.1 lcl|ptsI-XCC2809

277

800

S=570 I=32 E=1.71939e-61

phosphotransferase system enzyme I

XFF4834R

lcl|XALc_2146

428

800

S=558 I=37 E=4.14429e-60

putative phosphotransferase system (pts), enzymeIprotein

XFF4834R

lcl|ppsA-XALc_1645

599

796

S=165 I=28 E=1.83249e-12

probable phosphoenolpyruvate synthase protein

XFF4834R

lcl|ppsA-XALc_1645

425

499

S=107 I=37 E=2.05833e-05

probable phosphoenolpyruvate synthase protein

XFF4834R

YP_363933.1 lcl|ppsA-XCV2202

657

796

S=153 I=28 E=5.94098e-11

phosphoenolpyruvate synthase

XFF4834R

NP_642367.1 lcl|ppsA-XAC2041

657

796

S=152 I=28 E=6.31485e-11

phosphoenolpyruvate synthase

XFF4834R

NP_637522.1 lcl|ppsA-XCC2166

619

796

S=152 I=27 E=7.19716e-11

phosphoenolpyruvate synthase

XFF4834R

lcl|XALc_2145

165

235

S=101 I=32 E=9.71656e-05

putative phosphotransferase system (pts), hpr enzyme protein

pubmed

1

838

S=3396 I=83 E=0

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 7496537

 

prodomImg

pubmed

8

799

S=1355 I=41 E=5.31776e-155

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 2193161

 

prodomImg

pubmed

277

800

S=874 I=36 E=1.08173e-96

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Magnesium Metal-binding Transferase

Pubmed 15670601

 

prodomImg

pubmed

277

798

S=804 I=34 E=3.22343e-88

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7686067

 

prodomImg

pubmed

275

796

S=795 I=34 E=3.48364e-87

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1551842

 

prodomImg

sp_Pdown

sp|P45597|PTFAX_XANCP

1

838

S=3396 I=83 E=0

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

sp_Pdown

sp|P23388|PTFAX_RHOCA

8

799

S=1355 I=41 E=3.62112e-155

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

sp_Pdown

sp|Q9K8D3|PT1_BACHD

275

798

S=822 I=35 E=1.3376e-90

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

sp_Pdown

sp|O69251|PT1_BACME

275

796

S=808 I=34 E=7.70995e-89

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

sp_Pdown

sp|P08838|PT1_BACSU

277

798

S=804 I=34 E=2.19499e-88

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

PD000940

540

800

S=377 I=35 E=4.32068e-38

PD552666

425

508

S=228 I=51 E=5.20132e-20

PD933324

140

249

S=195 I=40 E=5.80614e-16

PD554617

265

310

S=166 I=70 E=1.87922e-12

PDA6H7Q3

681

732

S=164 I=63 E=3.28333e-12

PD592409

424

612

S=162 I=26 E=5.63738e-12

PDA1S479

135

170

S=161 I=89 E=5.88857e-12

PD190342

312

409

S=147 I=35 E=3.45389e-10

PD715246

421

499

S=143 I=41 E=9.7477e-10

PDA0X3V0

533

611

S=136 I=37 E=8.03963e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pkfuvprf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

92 hits
swiss-prot

Swiss-Prot ncbi-blastp

123 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
fruA XFF4834R_chr24990
XFF4834R_chr24980
XFF4834R_chr24980
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25000
XFF4834R_chr25000
ID fruA
AC XFF4834R_chr24990
LT XFF4834R_chr24990
OR XFF4834R_chr from 2890203 to 2891924 on strand +
DE PTS fructose porter IIBC component, probable
IP Phosphotransferase system, EIIB component, type 2/3; Phosphotransferase system, EIIC component, type 2
CL 4.4.A Phosphotransferase Systems (PEP-dependent PTS) GO:0009401
EC
GO InterPro
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: protein-N(PI)-phosphohistidine-sugar phosphotransferase activity (GO:0008982)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110119)
MW 58073.2 Da
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MSSSIVVIAAGERSTEAVLAAEALRRAATAAGRRVTIEIRSDQGVLGALP
GELANAATQVLVVGDADVDTARFGDAQLVRLSLGAVLDDPAAAIGKLAAH
ADPAVAGNPGGTASGSKRIVAITSCPTGIAHTFMAAEGLQQAAKKLGYQM
RVETQGSVGAQDALTDDEIRAADVVIIAADREVDLARFGGKRVFKSGTKP
AINDGPALINKALADASVQGGATPASATASKGRTGAYKHLMTGVSFMLPF
VTAGGLLIALAFALGGIYAGDDAHQGTLAWSLFQIGAKAGFTLMVPALAG
YIAYSIADRPGIAPGMIGGLVAANLNAGFLGGIIAGFIAGYGVAALNRYI
KLPRNLEGLKPVLILPVLGTLLVGLAMMYVFGQPVADLLAWLTAWLRGMH
GSSALLLGLLLGGMMAFDMGGPVNKAAYAFSTGLIASQVYTPMAAAMVAG
MTPPLGIALATWVFRNRFTAEERGSATAAGVLGLAFVTEGAIPYAARDPL
RTIPALVIGSAVAGAISMTAGAELKAPHGGIFVLLIPNAVTHLLNYVLAL
VVGVVVTAIALRLLKKPVTDVVA
XFF4834R

YP_364412.1 lcl|fruA-XCV2681

1

573

S=2115 I=76 E=0

PTS system, fructose-specific IIBC component (protein-N(pi)-phosphohistidine-sugar phosphotransferase)

XFF4834R

NP_642818.1 lcl|fruA-XAC2503

1

573

S=2077 I=75 E=0

PTS system, fructose-specific IIBC component

XFF4834R

NP_637726.1 lcl|fruA-XCC2372

1

573

S=1955 I=72 E=0

PTS system fructose-specific II BC component

pubmed

1

573

S=1955 I=72 E=0

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

Pubmed 1655739

 

prodomImg

pubmed

37

568

S=956 I=43 E=7.39109e-107

PTS system fructose-specific EIIBBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

Pubmed 2254279

 

prodomImg

pubmed

55

573

S=910 I=40 E=3.1844e-101

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell inner membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

Pubmed 3076173

 

prodomImg

pubmed

114

534

S=757 I=42 E=9.82951e-83

HI0446-like protein ; Cell membrane Phosphotransferase system Sugar transport Transmembrane

Pubmed 16714566

 

prodomImg

pubmed

103

536

S=677 I=40 E=5.11333e-73

PTS system, fructose C-specific enzyme II, BC component PTS system, fructose-specific enzyme II, BC component ; Transferase

Pubmed 15168170

 

prodomImg

sp_Pdown

sp|P23355|PTFBC_XANCP

1

573

S=1955 I=72 E=0

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

sp_Pdown

sp|P23387|PTF3E_RHOCA

37

568

S=956 I=43 E=5.02974e-107

PTS system fructose-specific EIIBBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

sp_Pdown

sp|P20966|PTFBC_ECOLI

55

573

S=910 I=40 E=2.16703e-101

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell inner membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

sp_Pdown

sp|P44714|PTFBC_HAEIN

114

534

S=749 I=42 E=5.96735e-82

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell inner membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

sp_Pdown

sp|P71012|PTF3A_BACSU

115

570

S=700 I=39 E=5.30128e-76

PTS system fructose-specific EIIABC component EC=2.7.1.- EC=2.7.1.69 ; Cell membrane Phosphoprotein Phosphotransferase Sugar transport Transmembrane

Iprscan IPR003501 [PF02302]

121

210

Phosphotransferase system, EIIB component, type 2/3

Iprscan IPR003353 [TIGR00829]

120

203

Phosphotransferase system, fructose-specific IIB subunit

Iprscan IPR006327 [TIGR01427]

222

565

Phosphotransferase system, fructose IIC component

Iprscan IPR013011 [PS51099]

119

214

Phosphotransferase system, EIIB component, type 2

Iprscan IPR013014 [PS51104]

236

573

Phosphotransferase system, EIIC component, type 2

Iprscan [seg]

15

35

-

Iprscan [seg]

166

184

-

Iprscan [seg]

253

270

-

Iprscan [seg]

327

345

-

Iprscan [seg]

398

421

-

Iprscan [seg]

543

561

-

Iprscan [tmhmm]

247

269

-

Iprscan [tmhmm]

282

304

-

Iprscan [tmhmm]

319

341

-

Iprscan [tmhmm]

362

384

-

Iprscan [tmhmm]

399

421

-

Iprscan [tmhmm]

442

464

-

Iprscan [tmhmm]

474

496

-

Iprscan [tmhmm]

503

522

-

Iprscan [tmhmm]

542

564

-

PD070264

1

89

S=255 I=65 E=2.47955e-23

PDA375U2

90

133

S=209 I=95 E=8.66596e-18

PD430508

238

324

S=186 I=47 E=6.15255e-15

PD132278

471

524

S=152 I=59 E=6.63259e-11

PDA375U3

90

133

S=118 I=60 E=1.08658e-06

PD522501

37

133

S=112 I=42 E=4.70106e-06

PD004040

134

216

S=104 I=43 E=5.40029e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one w7NW6llQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

20 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqlHMNQ/XFF4834R_chr24990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.