Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr09100rnkXFF4834R_chr09100regulator of nucleoside diphosphate kinase
  2. XFF4834R_chr12420XFF4834R_chr13060645_1406992_r3_XFF4834R-XFF4834R_chr12420XFF4834R_chr12420hypothetical conserved signalling protein
  3. XFF4834R_chr27700recXXFF4834R_chr27700probable regulatory protein Recx
  4. XFF4834R_chr28630XFF4834R_chr31180769_3296578_r3_XFF4834R-XFF4834R_chr28630XFF4834R_chr28630putative atp-binding_kinase_domain_fha protein
  5. XFF4834R_chr38170XFF4834R_chr_4411880_4412536_f2_XFF4834R-XFF4834R_chr38170XFF4834R_chr38170putative RIO kinase

rnk XFF4834R_chr09100
XFF4834R_chr09090
XFF4834R_chr09090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09110
XFF4834R_chr09110
ID rnk
AC XFF4834R_chr09100
LT XFF4834R_chr09100
OR XFF4834R_chr from 1048509 to 1048949 on strand -
DE regulator of nucleoside diphosphate kinase
IP Transcription elongation factor, GreA/GreB domain, prokaryotic
CL 3.1.4 Regulation level unknown
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription elongation regulator activity (GO:0003711)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN annotation based on Genprotec for rnk
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 15831.7 Da
SQ 146 aa
 
........10........20........30........40........50
| | | | |
MTSQHHSGLPPSILVSSHDLARLEALLDSPTFNKHPAAAALSDELGRARV
LPPDQIPGDVVTMHSRIECEDQLHGERHTLTLVYPHEADVQHGRISVLAP
VGSALLGLSIGQSIDWRTPDGRDLRLRVTAVHDQPAAAGDFRRAAR
Show or not Domain decomposition
 
XFF4834R

YP_362671.1 lcl|rnk-XCV0940

1

146

S=735 I=98 E=1.68036e-82

regulator of nucleoside diphosphate kinase

XFF4834R

NP_641255.2 lcl|rnk-XAC0903

1

146

S=721 I=96 E=8.27885e-81

regulator of nucleoside diphosphate kinase

XFF4834R

NP_636222.2 lcl|rnk-XCC0831

1

143

S=669 I=90 E=1.5432e-74

regulator of nucleoside diphosphate kinase

Iprscan IPR001437 [G3DSA:3.10.50.30]

51

131

Transcription elongation factor, GreA/GreB domain, prokaryotic

Iprscan IPR001437 [PF01272]

57

132

Transcription elongation factor, GreA/GreB domain, prokaryotic

Iprscan [SSF54534]

55

134

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FEsD204Z)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

97 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr09100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr09100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr09100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr09100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr13060645_1406992_r3_XFF4834R-XFF4834R_chr12420 XFF4834R_chr12420
XFF4834R_chr12410
XFF4834R_chr12410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12430
XFF4834R_chr12430
ID XFF4834R_chr13060645_1406992_r3_XFF4834R-XFF4834R_chr12420
AC XFF4834R_chr12420
LT XFF4834R_chr12420
OR XFF4834R_chr from 1406645 to 1406992 on strand -
DE hypothetical conserved signalling protein
IP Type IV pilus assembly PilZ
CL 3.1.4 Regulation level unknown
EC
GO InterPro


Curated
PM
AN Presence of a PilZ superfamily conserved domain. This domain is found in a wide variety of bacterial signalling proteins.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101023)
MW 12887.6 Da
SQ 115 aa
 
........10........20........30........40........50
| | | | |
MIQDTRRAPRRQPTDLLPVIDTLSEAQIGRVGNVSETGMLLLASVPLHDD
ALYQLRFSLPERVGRATEIDVGVHLLWSEAAHAPGQAWAGFRFLTMSEPH
RQRLRAWIAEEHLAG
XFF4834R

NP_643709.1 lcl|XAC3402-XAC3402

1

115

S=588 I=99 E=6.43671e-65

hypothetical protein

XFF4834R

YP_365250.1 lcl|XCV3519

1

115

S=587 I=99 E=9.52921e-65

hypothetical protein

XFF4834R

NP_638602.1 lcl|XCC3256

1

113

S=559 I=95 E=2.15725e-61

hypothetical protein

XFF4834R

lcl|XALc_0791

1

108

S=349 I=62 E=6.39322e-36

conserved hypothetical protein.

Iprscan IPR009875 [PF07238]

5

110

Type IV pilus assembly PilZ

PD289527

1

108

S=223 I=41 E=1.54847e-19

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hjJWtyqf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr12420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr12420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr12420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr12420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
recX XFF4834R_chr27700
XFF4834R_chr27690
XFF4834R_chr27690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27710
XFF4834R_chr27710
ID recX
AC XFF4834R_chr27700
LT XFF4834R_chr27700
OR XFF4834R_chr from 3199028 to 3199516 on strand -
DE probable regulatory protein Recx
IP Regulatory protein RecX
CL 3.1.4 Regulation level unknown
EC
GO InterPro
Biological Process: regulation of DNA repair (GO:0006282)

Curated
PM
AN regulatory protein for RecA
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100930)
MW 18156 Da
SQ 162 aa
 
........10........20........30........40........50
| | | | |
MDEQEPAPKRGRRFKEQTPVQRALGLLVRREHSRKELNRKLLARGIEPDA
AQAAVDRLTDEGWQDDTRFAAAVVRNRAGSGYGPLHIRAELGTHGLDSEA
ISAALATFEGDWTENARDLIRRRFGEQGPTDLPQRRKAADLLARRGFDGN
SVRAATRFDLED
Show or not Domain decomposition
 
Hamap RECX_MF_01114 raw_score=1646 norm_score=14.125

Regulatory protein recX [recX].

XFF4834R

YP_363505.1 lcl|recX-XCV1774

1

162

S=818 I=99 E=1.62906e-92

recombination regulator RecX

XFF4834R

NP_642072.1 lcl|recX-XAC1741

1

162

S=813 I=98 E=7.10978e-92

recombination regulator RecX

XFF4834R

NP_637093.1 lcl|recX-XCC1723

1

162

S=735 I=88 E=2.15409e-82

recombination regulator RecX

XFF4834R

lcl|recX-XALc_1172

4

162

S=565 I=71 E=7.83406e-62

probable regulatory protein recx

pubmed

1

162

S=813 I=98 E=2.36512e-90

Regulatory protein recX ; Cytoplasm

Pubmed 11178726

 

prodomImg

pubmed

1

162

S=786 I=94 E=5.12583e-87

Regulatory protein recX ; Cytoplasm

Pubmed 11728720,12007798

 

prodomImg

pubmed

1

162

S=735 I=88 E=7.16575e-81

Regulatory protein recX ; Cytoplasm

Pubmed 12007798

 

prodomImg

pubmed

23

152

S=236 I=42 E=1.73244e-20

Regulatory protein recX ; Cytoplasm

Pubmed 8165147

 

prodomImg

pubmed

23

162

S=236 I=41 E=2.21146e-20

Regulatory protein recX ; Cytoplasm

Pubmed 11053404

 

prodomImg

pubmed

18

152

S=229 I=41 E=1.23203e-19

Regulatory protein recX ; Cytoplasm

Pubmed 8468303

 

prodomImg

pubmed

18

131

S=227 I=45 E=2.74776e-19

Regulatory protein recX ; Cytoplasm

Pubmed 8294013,8165147

 

prodomImg

pubmed

23

152

S=195 I=35 E=2.01837e-15

Regulatory protein recX ; Cytoplasm

Pubmed 11251842,2121588

 

prodomImg

pubmed

20

147

S=184 I=36 E=4.0158e-14

Regulatory protein recX ; Cytoplasm DNA damage repair SOS response

Pubmed 7512687

 

prodomImg

pubmed

22

155

S=162 I=37 E=1.97687e-11

Regulatory protein recX ; Cytoplasm

Pubmed 12718403

 

prodomImg

sp_Pdown

sp|Q3BUQ8|RECX_XANC5

1

162

S=818 I=99 E=3.7779e-91

Regulatory protein recX ; Cytoplasm

sp_Pdown

sp|P0A0W7|RECX_XANCI

1

162

S=813 I=98 E=1.64881e-90

Regulatory protein recX ; Cytoplasm

sp_Pdown

sp|P0A0W6|RECX_XANAC

1

162

S=813 I=98 E=1.64881e-90

Regulatory protein recX ; Cytoplasm

sp_Pdown

sp|Q9AP31|RECX_XANOR

1

162

S=786 I=94 E=3.5734e-87

Regulatory protein recX ; Cytoplasm

sp_Pdown

sp|B2SUC9|RECX_XANOP

1

162

S=786 I=94 E=3.5734e-87

Regulatory protein recX ; Cytoplasm

Iprscan [MF_01114]

11

162

-

Iprscan IPR003783 [PF02631]

41

161

Regulatory protein RecX

PDA1R7B5

1

32

S=163 I=100 E=2.58371e-12

PD013331

27

74

S=118 I=52 E=6.83154e-07

PD009152

74

153

S=117 I=42 E=1.01137e-06

PD760457

2

80

S=110 I=42 E=7.19241e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one G4vI9Pha)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

141 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr27700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr27700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr27700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr27700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31180769_3296578_r3_XFF4834R-XFF4834R_chr28630 XFF4834R_chr28630
XFF4834R_chr_4697
XFF4834R_chr_4697
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28640
XFF4834R_chr28640
ID XFF4834R_chr31180769_3296578_r3_XFF4834R-XFF4834R_chr28630
AC XFF4834R_chr28630
LT XFF4834R_chr28630
OR XFF4834R_chr from 3295769 to 3296578 on strand -
DE putative atp-binding_kinase_domain_fha protein
IP Forkhead-associated; Beta tubulin, autoregulation binding site
CL 3.1.4 Regulation level unknown
EC
GO InterPro


Curated
PM
AN Structural: Xcv1686 is more or less 55 residues longer than XFF4834R 3019. But codon usage is really not good in this part. Start was not modified. Check Xcv1686 for mistake in predicting the start?
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101018)
MW 29509.4 Da
SQ 269 aa
 
........10........20........30........40........50
| | | | |
MRDLQVHFTHRQQPDHSLKPGVHRIVRHASGSVRVVGDAQGALLLAQFCL
DQRGLWLQVANGIRGIHVNGRPVRRMALLRAGDAIYADGVEMLLRSAPSS
APANDIHDDTASLGEVCLLLRGIGGRHHGRSFTLDRARLVGSDAAADIVI
DDPAFAAQHARLERHGDRVLIRDLGSEEGSWINGVQVRDGWLQAGDQVVF
DARHRFVVEVPRTHHSTTWDLPDTEPLPPPRAVAEPTRAPVKVARWPWLL
LSAVLLAAALSALLWFGAR
XFF4834R

NP_641977.1 lcl|XAC1645-XAC1645

1

269

S=1100 I=83 E=2.26969e-126

hypothetical protein

XFF4834R

YP_363417.1 lcl|XCV1686

1

269

S=1063 I=82 E=8.29287e-122

hypothetical protein

XFF4834R

NP_636956.2 lcl|XCC1585

1

269

S=990 I=74 E=6.22691e-113

hypothetical protein

XFF4834R

lcl|XALc_1707

3

269

S=573 I=51 E=2.09602e-62

putative atp-binding_kinase_domain_fha protein

Iprscan IPR000253 [G3DSA:2.60.200.20]

106

217

Forkhead-associated

Iprscan IPR000253 [PF00498]

138

201

Forkhead-associated

Iprscan IPR000253 [SM00240]

137

187

Forkhead-associated

Iprscan IPR013838 [PS00228]

1

4

Beta tubulin, autoregulation binding site

Iprscan IPR000253 [PS50006]

138

187

Forkhead-associated

Iprscan [seg]

118

130

-

Iprscan [seg]

143

157

-

Iprscan [seg]

249

264

-

Iprscan [tmhmm]

246

268

-

PD457459

4

142

S=554 I=82 E=1.1446e-59

PD694859

200

248

S=244 I=96 E=4.75973e-22

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eFuJRQSV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr28630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr28630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr28630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr28630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4411880_4412536_f2_XFF4834R-XFF4834R_chr38170 XFF4834R_chr38170
XFF4834R_chr_4060
XFF4834R_chr_4060
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38180
XFF4834R_chr38180
ID XFF4834R_chr_4411880_4412536_f2_XFF4834R-XFF4834R_chr38170
AC XFF4834R_chr38170
LT XFF4834R_chr38170
OR XFF4834R_chr from 4411880 to 4412536 on strand +
DE putative RIO kinase
IP RIO-like kinase
CL 3.1.4 Regulation level unknown
EC
GO InterPro
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases [6]. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date. Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. Blast on NCBI identifies a domain belonging to Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. Thus this protein may be involoved in various phenomena: signalling or antibiotic resistance.
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101021)
MW 24686.5 Da
SQ 218 aa
 
........10........20........30........40........50
| | | | |
MHYQPLDVSSLHLITPVLLKQGTRLLEPDVYRTHLNGQPAVVKDYGRYRR
TLLAPIARLMVRHEASMLRQLQGWRHAPALLGTLGGLALGMEFIPGDTLS
ASTVVGQEVFQQLQQALRRLHAFGITHNDLHGTNVVVSTGVPVLIDFTSA
WRFPRWLRRGTLARQLRRSDVANFQKMRHRLAGIAPSADESARSAEPRWI
HAIRSGWKRLYPRLKCKA
XFF4834R

YP_365773.1 lcl|XCV4042

1

218

S=965 I=85 E=4.58861e-110

putative kinase

XFF4834R

NP_644228.1 lcl|XAC3927-XAC3927

35

218

S=806 I=85 E=7.62045e-91

hypothetical protein

XFF4834R

NP_639211.1 lcl|XCC3871

41

218

S=654 I=72 E=2.37286e-72

hypothetical protein

Iprscan IPR018934 [PF01163]

29

191

RIO-like kinase

Iprscan [seg]

79

90

-

Iprscan [seg]

111

120

-

PD893472

148

218

S=267 I=73 E=6.72137e-25

PD603509

41

78

S=177 I=92 E=5.99833e-14

PDA314X2

1

39

S=170 I=82 E=4.19199e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eWuOvSjt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr38170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr38170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr38170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBznnSU5/XFF4834R_chr38170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.