Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr27680csrAXFF4834R_chr27680probable pleiotropic regulatory protein for carbon source metabolism

csrA XFF4834R_chr27680
XFF4834R_chr27670
XFF4834R_chr27670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27690
XFF4834R_chr27690
ID csrA
AC XFF4834R_chr27680
LT XFF4834R_chr27680
OR XFF4834R_chr from 3195926 to 3196138 on strand -
DE probable pleiotropic regulatory protein for carbon source metabolism
IP Carbon storage regulator
CL 3.1.3.7 binding, sequestering
EC
GO InterPro
Biological Process: regulation of carbohydrate metabolic process (GO:0006109)
Biological Process: mRNA catabolic process (GO:0006402)
Molecular Function: RNA binding (GO:0003723)

Curated
PM
AN structural: codon usage is excellent upstream the predicted start. Presence of numerous possible starts. Could be extended in Nter. I did not do irt to stay coherent with the homologs in the other xanthomonas: csrA1-Xcv, csrA-Xac1743 and Xcc 1725. Functionnal: Similarities with csra from coli. Blasting the sequence of csra of coli on the genomeof Xanch retrieves only 1 single hit. This hit is located within XFF4834R 2919. CsrA, a post-transcriptional regulator that affects translation of its gene targets by binding mRNAs. CsrA controls a large variety of physiological processes such as central carbon metabolism, motility and biofilm formation. The activity of CsrA is itself tightly regulated by the CsrB and CsrC small RNAs and the BarA-UvrY two-component system.(Timmermans J et Van Melderen L, 2010, review)
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101018)
MW 7565.5 Da
SQ 70 aa
 
........10........20........30........40........50
| | | | |
MLILTRRVGETLMIGDSVTVTVLGVKGNQVRIGITAPKDVAVHREEIYQR
IQRGDEPVASGAHHGDDSSN
Show or not Domain decomposition
 
Hamap CSRA_MF_00167 raw_score=1910 norm_score=21.753

Carbon storage regulator [csrA].

X.species

YP_363507.1 lcl|csrA1-XCV1776

1

70

S=355 I=100 E=5.34258e-37

carbon storage regulator

X.species

NP_642074.1 lcl|csrA-XAC1743

1

70

S=355 I=100 E=5.34258e-37

carbon storage regulator

X.species

NP_637095.1 lcl|csrA-XCC1725

1

70

S=328 I=93 E=1.01593e-33

carbon storage regulator

X.species

lcl|csrA-XALc_1174

1

70

S=279 I=84 E=9.51006e-28

probable carbon storage regulator protein

X.species

YP_361686.1 lcl|csrA2-XCVd0127

7

52

S=112 I=50 E=1.48462e-07

carbon storage regulator

pubmed

1

60

S=243 I=82 E=9.25103e-22

CsrA-like protein ; Plasmid RNA-binding

Pubmed 16202450

 

prodomImg

pubmed

1

52

S=242 I=90 E=1.13052e-21

Carbon storage regulator ; RNA-binding

Pubmed 11083797

 

prodomImg

pubmed

1

52

S=242 I=90 E=1.13052e-21

Carbon storage regulator ; RNA-binding

Pubmed 8393005,8604133

 

prodomImg

pubmed

1

53

S=242 I=89 E=1.15041e-21

RsmA ; RNA-binding

Pubmed 17263850

 

prodomImg

pubmed

1

53

S=242 I=89 E=1.15041e-21

Carbon storage regulator homolog ; RNA-binding

Pubmed 16104018

 

prodomImg

pubmed

1

52

S=241 I=90 E=1.89097e-21

Carbon storage regulator homolog ; RNA-binding

Pubmed 11287746

 

prodomImg

pubmed

1

52

S=236 I=88 E=6.75326e-21

Carbon storage regulator homolog ; RNA-binding

Pubmed 7665490

 

prodomImg

pubmed

1

56

S=228 I=79 E=6.51635e-20

Global regulator ; RNA-binding

Pubmed 11727819

 

prodomImg

pubmed

1

54

S=219 I=78 E=8.16754e-19

Translational repressor ; RNA-binding

Pubmed 15601712

 

prodomImg

pubmed

1

52

S=218 I=73 E=9.14778e-19

Carbon storage regulator homolog ; RNA-binding

Pubmed 17038625

 

prodomImg

sp

1

70

S=355 I=100 E=1.59142e-35

Carbon storage regulator homolog ; RNA-binding

 

prodomImg

sp

1

70

S=355 I=100 E=1.59142e-35

Carbon storage regulator homolog ; RNA-binding

 

prodomImg

sp

1

70

S=355 I=100 E=1.59142e-35

Carbon storage regulator homolog ; RNA-binding

 

prodomImg

sp

1

70

S=355 I=100 E=1.59142e-35

Carbon storage regulator homolog ; RNA-binding

 

prodomImg

sp

1

70

S=355 I=100 E=1.59142e-35

Carbon storage regulator homolog ; RNA-binding

 

prodomImg

Iprscan IPR003751 [PD009007]

1

48

Carbon storage regulator

Iprscan IPR003751 [MF_00167]

1

70

Carbon storage regulator

Iprscan IPR003751 [PF02599]

1

61

Carbon storage regulator

Iprscan IPR003751 [TIGR00202]

1

62

Carbon storage regulator

PD009007

1

49

S=198 I=76 E=1.79465e-16

PDA2V2P0

49

70

S=101 I=86 E=9.32021e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4FTxFFbd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

233 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAJ1SUK/XFF4834R_chr27680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAJ1SUK/XFF4834R_chr27680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAJ1SUK/XFF4834R_chr27680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAJ1SUK/XFF4834R_chr27680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.