Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr01490XFF4834R_chr01670549_0189619_f2_XFF4834R-XFF4834R_chr01490XFF4834R_chr01490putative metalloprotease
  2. XFF4834R_chr06200XFF4834R_chr06380646_0702525_r1_XFF4834R-XFF4834R_chr06200XFF4834R_chr06200putative zinc metalloprotease precursor
  3. XFF4834R_chr07910XFF4834R_chr08370943_0914884_f2_XFF4834R-XFF4834R_chr07910XFF4834R_chr07910Putative peptidase
  4. XFF4834R_chr30830rsePXFF4834R_chr30830putative membrane-associated zinc metalloprotease

XFF4834R_chr01670549_0189619_f2_XFF4834R-XFF4834R_chr01490 XFF4834R_chr01490
XFF4834R_chr01480
XFF4834R_chr01480
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01500
XFF4834R_chr01500
ID XFF4834R_chr01670549_0189619_f2_XFF4834R-XFF4834R_chr01490
AC XFF4834R_chr01490
LT XFF4834R_chr01490
OR XFF4834R_chr from 188549 to 189619 on strand +
DE putative metalloprotease
IP Peptidase M4, thermolysin C-terminal; Peptidase M4, thermolysin
CL 3.1.3.4 Proteases, cleavage of compounds GO:0008233
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: extracellular region (GO:0005576)
Molecular Function: metalloendopeptidase activity (GO:0004222)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by verdier (20101020)
MW 37893.9 Da
SQ 356 aa
 
........10........20........30........40........50
| | | | |
MSTFVSPRRAGILPPYLLEHVAQAAPAHARQCALLSRQITAQLRQRRALG
LLARADAPTADAKAQQSAQAVQRRIYDAQQGTTLPGTLARDEGAPATQDV
AVTEAYDYLGATHDFFQTVYGRNSIDAAGMPLIGTVHYERGYDNAFWNGE
QMVFGDGDGEVFNRFTIAIDVVGHELTHGVTERTANLIYQGQSGALNESI
SDVFGVLIKQYTLGQSADQADWIIGAGLLMPGIQGVGLRSMQAPGSAYDD
PALGKDPQPATMAGYVDTQEDDGGVHYNSGIPNHAFYRAAIAIGGAAWEK
TGRIWYRALTGGELAAGADFATFADLTASVASADYGANSREAVAVRQAWR
DVGVLA
XFF4834R

XFF4834R_chr04570 lcl|XFF4834R_chr_0524085_0525683_r2_XFF4834R-XFF4834R_chr04570

76

287

S=291 I=36 E=9.34004e-29

XFF4834R

NP_640460.1 lcl|XAC0104-XAC0104

1

356

S=1618 I=88 E=0

metalloprotease

XFF4834R

YP_361806.1 lcl|XCV0075

1

356

S=1517 I=83 E=9.72363e-177

Zinc metalloprotease

XFF4834R

NP_635471.1 lcl|XCC0076

1

356

S=1322 I=72 E=4.09104e-153

metalloprotease

XFF4834R

NP_640820.2 lcl|XAC0465-XAC0465

76

287

S=290 I=36 E=4.54334e-28

metalloproteinase

XFF4834R

YP_362226.1 lcl|XCV0495

76

287

S=290 I=36 E=4.62326e-28

Zinc metalloprotease precursor

pubmed

71

354

S=953 I=64 E=1.00214e-106

Metalloproteinase

Pubmed 16442309

 

prodomImg

pubmed

67

354

S=949 I=64 E=2.70764e-106

Grimelysin

Pubmed 18190782

 

prodomImg

pubmed

67

354

S=949 I=64 E=2.70764e-106

Grimelysin ; Signal

Pubmed 18190782

 

prodomImg

pubmed

71

355

S=942 I=65 E=2.02896e-105

Zinc metalloprotease

Pubmed 17483271

 

prodomImg

pubmed

73

354

S=924 I=62 E=3.21538e-103

Extracellular metalloprotease EC=3.4.24.- ; Calcium Hydrolase Metal-binding Secreted Signal Zinc Zymogen

Pubmed 1917878

 

prodomImg

pubmed

93

300

S=552 I=53 E=3.12391e-58

Extracellular minor metalloprotease EC=3.4.24.- ; Hydrolase Metal-binding Secreted Signal Zinc Zymogen

Pubmed 8449415

 

prodomImg

pubmed

74

349

S=546 I=46 E=1.94924e-57

Neutral protease

Pubmed 15635941

 

prodomImg

pubmed

76

354

S=533 I=44 E=8.06682e-56

Bacillolysin EC=3.4.24.28 ; Calcium Hydrolase Metal-binding Metalloprotease Secreted Signal Zinc Zymogen

Pubmed 8450307,7764969

 

prodomImg

pubmed

74

354

S=517 I=44 E=6.94395e-54

Protease

Pubmed 15277758

 

prodomImg

pubmed

76

354

S=513 I=43 E=1.74975e-53

Thermolysin EC=3.4.24.27 ; Calcium Hydrolase Metal-binding Metalloprotease Secreted Signal Zinc Zymogen

Pubmed 2993245

 

prodomImg

sp_Pdown

sp|Q99132|PRT1_PECCC

73

354

S=924 I=62 E=2.2131e-103

Extracellular metalloprotease EC=3.4.24.- ; Calcium Hydrolase Metal-binding Secreted Signal Zinc Zymogen

sp_Pdown

sp|Q06517|SMP_SERME

93

300

S=552 I=53 E=2.15014e-58

Extracellular minor metalloprotease EC=3.4.24.- ; Hydrolase Metal-binding Secreted Signal Zinc Zymogen

sp_Pdown

sp|Q00891|NPRM_BACME

76

354

S=533 I=44 E=5.55228e-56

Bacillolysin EC=3.4.24.28 ; Calcium Hydrolase Metal-binding Metalloprotease Secreted Signal Zinc Zymogen

sp_Pdown

sp|P06874|THER_BACST

76

354

S=513 I=43 E=1.20433e-53

Thermolysin EC=3.4.24.27 ; Calcium Hydrolase Metal-binding Metalloprotease Secreted Signal Zinc Zymogen

sp_Pdown

sp|Q59223|THER_BACSO

76

354

S=510 I=43 E=2.98223e-53

Thermolysin EC=3.4.24.27 ; Calcium Hydrolase Metal-binding Metalloprotease Secreted Signal Zinc Zymogen

Iprscan IPR013856 [G3DSA:3.10.170.10]

74

186

Peptidase M4, thermolysin

Iprscan IPR001570 [G3DSA:1.10.390.10]

187

354

Peptidase M4, thermolysin C-terminal

Iprscan IPR013856 [PF01447]

76

183

Peptidase M4, thermolysin

Iprscan IPR001570 [PF02868]

185

354

Peptidase M4, thermolysin C-terminal

Iprscan [PS00142]

171

180

-

Iprscan [seg]

22

33

-

Iprscan [seg]

41

64

-

PD001862

95

354

S=554 I=50 E=1.31057e-59

PDA3Q587

319

356

S=136 I=76 E=5.98562e-09

PD129003

93

179

S=125 I=34 E=1.20134e-07

PD693284

1

75

S=123 I=40 E=2.02702e-07

PDA0E7A9

103

207

S=120 I=28 E=4.21622e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one doD3YQeb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

177 hits
swiss-prot

Swiss-Prot ncbi-blastp

31 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr01490.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr01490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr01490.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr01490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr06380646_0702525_r1_XFF4834R-XFF4834R_chr06200 XFF4834R_chr06200
XFF4834R_chr06190
XFF4834R_chr06190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06210
XFF4834R_chr06210
ID XFF4834R_chr06380646_0702525_r1_XFF4834R-XFF4834R_chr06200
AC XFF4834R_chr06200
LT XFF4834R_chr06200
OR XFF4834R_chr from 699646 to 702525 on strand -
DE putative zinc metalloprotease precursor
IP Peptidase M16, C-terminal; Peptidase M16, N-terminal
CL 3.1.3.4 Proteases, cleavage of compounds GO:0008233
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: metalloendopeptidase activity (GO:0004222)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: acur
CC STATUS: curated by pieretti (20100427)
MW 103172.1 Da
SQ 959 aa
 
........10........20........30........40........50
| | | | |
MLRPLSLLIAGVLGVAAGSVAPPVAAAPASLSKSAASSAIPDIAYTRFTL
PNGLTVVVHEDHKAPVVAVSIWYHIGSGDEPAGKTGFAHLFEHLMFSGSE
NNKGSFFAPLEKVGTTDMNGTTWFDRTNYFETVPTTALDTALWLESDRMG
HLLGAIGQQELDTQRGVVQNEKRQGENRPYGRVDQNILSNLFPANHPYQH
DTIGSMEDLDAASLADVKQWFNDNYGAANTTLVLAGDITVAQARAKALQY
FGDITSGKPAARQQPWVTPLAAQKRGVQHDHVSQPRIYRTWAAPQLGTDD
LIQLDLATTVLGGGKTSRLYQRLVYQDNLVDDVSASVQPFALSSQVQIQA
DVKDGVDPAKVEAIIDEELKKFIAQGPTADELQRAQVAYRAGFVRGLEKV
GGFTGKAVILAEGQVYRGDPGAYKKDLQRAQAATADSVKQASATWFGKGD
YLLTVLPAGKDFDPAAEDKAVVARGEEPGKPAPKLPAAGTFKVTASTLDR
SKGVPQTDQFPDLSFPKLQRGKLKNGIEVILAERHTIPVTQVELLFDAGY
AADQGSKLGTASFSAALMNESTTALDSVEVAQHRQRLGAITAVGCDLDSC
SASLDALNDQLQPSLQLFSDIVRNPAFKAADIERVRGQWLSGIAQEKTQP
NSLALRALPPLLFGNQHPYGIPLTGSGTAAAIKSLNAQDLQNFHSQWLRP
DNLRILVAGDTTLAQIIPQLDATFGDWKAPTTALPKKNLANVAAQPKPRV
YLINRPDAPQSVILAGLLAPSTKAPDNLAIGVANGAFGGTFTSRLNMNLR
ENKRWAYGAGTRMMDAQGQRPYLFSAPVQTDKTAESANEIFKEATAIIGD
KPLTADEIEKIKNQRIRALPGSFETTGAVLGAIEGIVQFDRPDDYVQTLK
PRLEAIDQPAAQKAIKEIIKPQAMTWVIVGDLKKIEAPVRALKLGEVQVL
DVDGKPVKR
XFF4834R

YP_362397.1 lcl|XCV0666

42

959

S=4638 I=97 E=0

putative zinc metalloprotease precursor

XFF4834R

NP_640962.1 lcl|XAC0609-XAC0609

42

959

S=4612 I=97 E=0

zinc protease

XFF4834R

NP_638870.1 lcl|XCC3524

42

959

S=4466 I=91 E=0

zinc protease

XFF4834R

lcl|XALc_2970

490

958

S=1902 I=77 E=0

hypothetical protein

pubmed

48

878

S=488 I=24 E=6.60864e-50

Zinc protease

Pubmed 16309397

 

prodomImg

pubmed

48

656

S=465 I=27 E=4.49178e-47

Protease

Pubmed 8606199

 

prodomImg

pubmed

516

749

S=122 I=24 E=1.51014e-05

Protease

Pubmed 8606199

 

prodomImg

pubmed

52

254

S=327 I=37 E=1.93435e-30

Protease

Pubmed 11483153

 

prodomImg

pubmed

42

410

S=312 I=27 E=1.53943e-28

Protease A

Pubmed 12654844

 

prodomImg

pubmed

50

446

S=282 I=26 E=5.62939e-25

Zn-dependent peptidase Putative coenzyme PQQ synthesis protein F

Pubmed 18004300

 

prodomImg

pubmed

513

862

S=175 I=22 E=4.84353e-12

Zn-dependent peptidase Putative coenzyme PQQ synthesis protein F

Pubmed 18004300

 

prodomImg

pubmed

46

456

S=246 I=24 E=1.18754e-20

Putative protease

Pubmed 14617179

 

prodomImg

pubmed

520

930

S=187 I=24 E=1.68794e-13

Putative protease

Pubmed 14617179

 

prodomImg

pubmed

46

456

S=221 I=24 E=1.63555e-17

M16 peptidase

Pubmed 17971441

 

prodomImg

sp_Pdown

sp|P55679|Y4WA_RHISN

48

405

S=446 I=32 E=6.15176e-45

Uncharacterized zinc protease y4wA EC=3.4.24.- ; Cell membrane Hydrolase Metal-binding Metalloprotease Plasmid Transmembrane

sp_Pdown

sp|P55679|Y4WA_RHISN

523

921

S=156 I=23 E=8.24909e-10

Uncharacterized zinc protease y4wA EC=3.4.24.- ; Cell membrane Hydrolase Metal-binding Metalloprotease Plasmid Transmembrane

sp_Pdown

sp|O32965|Y855_MYCLE

46

398

S=244 I=27 E=1.5733e-20

Uncharacterized zinc protease ML0855 EC=3.4.24.- ; Hydrolase Metal-binding Metalloprotease

sp_Pdown

sp|O32965|Y855_MYCLE

520

807

S=207 I=26 E=4.66308e-16

Uncharacterized zinc protease ML0855 EC=3.4.24.- ; Hydrolase Metal-binding Metalloprotease

sp_Pdown

sp|O86835|Y5738_STRCO

47

457

S=241 I=25 E=3.41829e-20

Uncharacterized zinc protease SCO5738 EC=3.4.24.- ; Hydrolase Metal-binding Metalloprotease

PD545067

395

467

S=253 I=67 E=5.03874e-23

PDA9E8S0

515

792

S=168 I=27 E=1.16409e-12

PD250217

518

609

S=164 I=39 E=3.25682e-12

PD250217

47

102

S=108 I=39 E=1.85319e-05

PDA8N5T5

610

792

S=158 I=30 E=1.8303e-11

PDA1T240

495

525

S=155 I=97 E=3.64465e-11

PD000718

54

147

S=155 I=39 E=4.3013e-11

PDA1V1C4

931

959

S=136 I=97 E=7.9055e-09

PDA220D6

493

712

S=131 I=23 E=3.05378e-08

PD813996

305

386

S=126 I=41 E=1.2871e-07

PDA2O420

316

385

S=122 I=41 E=4.10408e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wZua5Gx5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

45 hits
swiss-prot

Swiss-Prot ncbi-blastp

51 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr06200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr06200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr06200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr06200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr08370943_0914884_f2_XFF4834R-XFF4834R_chr07910 XFF4834R_chr07910
XFF4834R_chr07900
XFF4834R_chr07900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07920
XFF4834R_chr07920
ID XFF4834R_chr08370943_0914884_f2_XFF4834R-XFF4834R_chr07910
AC XFF4834R_chr07910
LT XFF4834R_chr07910
OR XFF4834R_chr from 913943 to 914884 on strand +
DE Putative peptidase
IP Peptidase M23B; Peptidase M23
CL 3.1.3.4 Proteases, cleavage of compounds GO:0008233
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Molecular Function: metalloendopeptidase activity (GO:0004222)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100820)
MW 33213.2 Da
SQ 313 aa
 
........10........20........30........40........50
| | | | |
MALNKVVIKSRQTRAQRVARQFQDFAADRPMVVLGAVLGLGMLIGVGAST
ATGMVTNSALQAKVAQQQVELAQAQRASQAQVNALAARLGELQAQATRLN
ALGERLTEMGKLKDGEFDFDEPVGVGGGDEPVSDMPVQDFKETLGQVEQQ
FSASGQQLNVLASLMFDHQLEQNSVPSRMPIRNTYITSGFGGRADPFDGG
SAFHKGVDFHANVGDPVLSVADGVVSYAGVRGGYGNVVEVDHGNGYVTRY
AHNSRLVVKVGDLVRAGQQVARAGSSGRSTGAHVHFEVWADGRVVNPRKF
LGETTPVGRQGRG
XFF4834R

XFF4834R_chr37850 lcl|XFF4834R_chr40950456_4376874_f1_XFF4834R-XFF4834R_chr37850

178

297

S=240 I=40 E=1.23176e-22

XFF4834R

XFF4834R_chr00250 lcl|envC-XFF4834R_chr00250

205

301

S=185 I=41 E=6.94805e-16

protease with a role in cell division

XFF4834R

XFF4834R_chr23660 lcl|XFF4834R_chr25860280_2737122_f1_XFF4834R-XFF4834R_chr23660

188

294

S=165 I=41 E=1.48103e-13

XFF4834R

XFF4834R_chr27830 lcl|XFF4834R_chr30420042_3212839_r3_XFF4834R-XFF4834R_chr27830

186

301

S=165 I=35 E=1.53359e-13

tetratricopeptide repeat transcriptional regulator

XFF4834R

XFF4834R_chr12820 lcl|XFF4834R_chr13510014_1459733_r2_XFF4834R-XFF4834R_chr12820

204

301

S=123 I=32 E=1.83406e-08

XFF4834R

XFF4834R_chr15990 lcl|XFF4834R_chr_1845993_1847018_r2_XFF4834R-XFF4834R_chr15990

178

303

S=121 I=31 E=3.84827e-08

XFF4834R

NP_641139.1 lcl|XAC0787-XAC0787

1

313

S=1276 I=83 E=1.52841e-147

peptidase

XFF4834R

YP_362569.1 lcl|XCV0838

1

313

S=1257 I=82 E=3.37355e-145

membrane-bound metalloendopeptidase

XFF4834R

NP_636124.1 lcl|XCC0733

1

313

S=1190 I=77 E=3.88648e-137

peptidase

XFF4834R

lcl|XALc_2806

1

313

S=859 I=57 E=5.32733e-97

putative membrane-bound metalloendopeptidase protein

XFF4834R

lcl|XALc_0382

178

297

S=253 I=40 E=1.43947e-23

hypothetical membrane-bound metalloendopeptidase protein

XFF4834R

YP_365742.1 lcl|XCV4011

178

297

S=240 I=40 E=4.50683e-22

membrane-bound metalloendopeptidase

XFF4834R

NP_639182.1 lcl|XCC3842

178

297

S=240 I=41 E=4.5861e-22

hypothetical protein

XFF4834R

NP_644199.1 lcl|XAC3898-XAC3898

178

297

S=240 I=40 E=5.31881e-22

hypothetical protein

XFF4834R

NP_635417.1 lcl|XCC0022

205

301

S=188 I=41 E=1.06306e-15

hypothetical protein

XFF4834R

lcl|XALc_0392

186

301

S=188 I=39 E=1.09123e-15

putative peptidase protein

XFF4834R

NP_640380.1 lcl|XAC0024-XAC0024

205

301

S=185 I=41 E=2.08027e-15

hypothetical protein

XFF4834R

lcl|XALc_1160

197

301

S=185 I=41 E=2.26978e-15

putative outer membrane lipoprotein precursor

XFF4834R

YP_361756.1 lcl|XCV0025

205

301

S=184 I=41 E=2.8473e-15

putative peptidase

XFF4834R

YP_364291.1 lcl|XCV2560

188

304

S=169 I=40 E=1.9034e-13

metalloendopeptidase precursor

XFF4834R

NP_642677.1 lcl|XAC2361-XAC2361

188

304

S=169 I=40 E=2.0409e-13

peptidase

XFF4834R

YP_363492.1 lcl|nlpD-XCV1761

186

301

S=168 I=36 E=2.74513e-13

outer membrane lipoprotein

XFF4834R

NP_642059.1 lcl|nlpD-XAC1728

186

301

S=167 I=36 E=3.89065e-13

lipoprotein

XFF4834R

NP_637079.1 lcl|nlpD-XCC1709

186

301

S=162 I=35 E=1.48986e-12

lipoprotein

XFF4834R

NP_637613.1 lcl|XCC2258

202

294

S=157 I=41 E=5.00574e-12

peptidase

XFF4834R

lcl|XALc_1914

188

304

S=149 I=36 E=4.6241e-11

putative metalloendopeptidase, m23b family protein

XFF4834R

NP_638206.2 lcl|XCC2858

167

288

S=134 I=33 E=3.74478e-09

hypothetical protein

XFF4834R

NP_643350.2 lcl|XAC3041-XAC3041

178

288

S=127 I=31 E=2.3571e-08

hypothetical protein

XFF4834R

YP_364909.1 lcl|XCV3178

178

288

S=127 I=31 E=2.68643e-08

putative metalloendopeptidase precursor

XFF4834R

YP_365218.1 lcl|XCV3487

204

307

S=122 I=31 E=9.51085e-08

putative metalloendopeptidase

XFF4834R

NP_638557.1 lcl|XCC3211

204

301

S=119 I=32 E=2.35513e-07

hypothetical protein

XFF4834R

NP_643675.1 lcl|XAC3368-XAC3368

204

301

S=113 I=31 E=1.11177e-06

hypothetical protein

XFF4834R

lcl|XALc_2187

179

288

S=102 I=31 E=2.72685e-05

putative membrane metalloendopeptidase protein

pubmed

78

305

S=451 I=44 E=4.89661e-46

Putative uncharacterized protein

Pubmed 8581173

 

prodomImg

pubmed

173

301

S=276 I=44 E=1.0008e-24

Putative lipoprotein NlpD

Pubmed 17333169,15101981

 

prodomImg

pubmed

174

301

S=267 I=37 E=1.08159e-23

Putative uncharacterized protein

Pubmed 11319266

 

prodomImg

pubmed

174

301

S=264 I=37 E=2.28929e-23

Putative uncharacterized protein

Pubmed 11319266

 

prodomImg

pubmed

179

301

S=255 I=40 E=2.77103e-22

NlpD

Pubmed 12949258

 

prodomImg

sp_Pdown

sp|Q89AI9|Y296_BUCBP

165

298

S=265 I=34 E=1.21081e-23

Uncharacterized metalloprotease bbp_296 EC=3.4.24.- ; Cell membrane Hydrolase Metal-binding Transmembrane Zinc

sp_Pdown

sp|P0AFT1|YEBA_SHIFL

178

297

S=257 I=44 E=1.33158e-22

Uncharacterized metalloprotease yebA EC=3.4.24.- ; Cell membrane wall biogenesis/degradation Hydrolase Metal-binding Transmembrane Zinc

sp_Pdown

sp|P0AFS9|YEBA_ECOLI

178

297

S=257 I=44 E=1.33158e-22

Uncharacterized metalloprotease yebA EC=3.4.24.- ; Cell membrane wall biogenesis/degradation Hydrolase Metal-binding Transmembrane Zinc

sp_Pdown

sp|P0AFT0|YEBA_ECOL6

178

297

S=257 I=44 E=1.33158e-22

Uncharacterized metalloprotease yebA EC=3.4.24.- ; Cell membrane wall biogenesis/degradation Hydrolase Metal-binding Transmembrane Zinc

sp_Pdown

sp|P44693|Y409_HAEIN

177

297

S=225 I=41 E=1.00403e-18

Uncharacterized metalloprotease HI_0409 EC=3.4.24.- ; Cell membrane Hydrolase Metal-binding Transmembrane Zinc

Iprscan [coil]

57

78

-

Iprscan [coil]

82

103

-

Iprscan IPR002886 [PTHR21666:SF7]

171

304

Peptidase M23B

Iprscan [PTHR21666]

171

304

-

Iprscan IPR016047 [PF01551]

203

297

Peptidase M23

Iprscan [seg]

31

48

-

Iprscan [seg]

59

77

-

Iprscan [seg]

117

132

-

Iprscan [tmhmm]

32

54

-

PD358979

49

177

S=239 I=43 E=1.64924e-21

PD001525

224

301

S=160 I=46 E=6.6048e-12

PD604127

1

30

S=125 I=83 E=1.29944e-07

PD077678

186

270

S=111 I=38 E=5.52018e-06

PDA903K5

203

304

S=109 I=30 E=9.15315e-06

Iprscan IPR011055 [SSF51261]

60

301

Duplicated hybrid motif

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nUlkRP9z)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

107 hits
swiss-prot

Swiss-Prot ncbi-blastp

34 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr07910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr07910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr07910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr07910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rseP XFF4834R_chr30830
XFF4834R_chr30820
XFF4834R_chr30820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30840
XFF4834R_chr30840
ID rseP
AC XFF4834R_chr30830
LT XFF4834R_chr30830
OR XFF4834R_chr from 3546503 to 3547849 on strand +
DE putative membrane-associated zinc metalloprotease
IP Peptidase M50, putative membrane-associated zinc metallopeptidase
CL 3.1.3.4 Proteases, cleavage of compounds GO:0008233
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: metalloendopeptidase activity (GO:0004222)
Molecular Function: protein binding (GO:0005515)

Curated
PM
AN start change
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100625)
MW 48340.8 Da
SQ 448 aa
 
........10........20........30........40........50
| | | | |
MGDFIGSVWWMIVSLGVLVTFHEFGHFWVARRCGVKVLRFSVGFGKPLWM
RRDRHGTEFVVAAIPLGGYVKMLDEREGDVHPAEQDQAFNRKTVWQRIAI
VAAGPIANLLLCMAMLWAMFVVGKQDYSATVGRADGLAAEAGLTAGERIV
RIDGRSVSSWSDASLQLTTAAMDRRDVRVLTASDTASSSEHTLRLSQLPV
GFDERRVAALAGIGWQFMLQPPVIAEVVKGSVADGLLKPGDRIVAIDGQP
IRSAEDIIPQVQALGAHGGPGMIEVARGEDRLALEIAPRKSPQGQWMIGV
RPAAAPAPAYDSRQQYGLFAAVPAAIRETGRMTADSLGMMKRMLTGQASV
KNISGPVTIARAANASAERGLDWFLYFLGLLSLSLAIINLMPIPILDGGH
LLYYLIELIKGSPISERAMIAGQYVGLAVLAGLMGLAFYNDILGLVPR
XFF4834R

NP_641749.1 lcl|XAC1414-XAC1414

1

448

S=2059 I=90 E=0

hypothetical protein

XFF4834R

YP_363202.1 lcl|XCV1471

1

448

S=2032 I=89 E=0

putative membrane-associated zinc metalloprotease

XFF4834R

NP_636740.1 lcl|XCC1366

1

448

S=1871 I=81 E=0

hypothetical protein

XFF4834R

lcl|XALc_2033

1

448

S=1431 I=62 E=4.24685e-166

putative membrane-associated zinc metalloprotease protein

pubmed

12

442

S=741 I=43 E=6.43018e-81

MucP ; Cell membrane Hydrolase Metal-binding Metalloprotease Transmembrane Zinc

Pubmed 17470813

 

prodomImg

pubmed

12

442

S=737 I=42 E=1.87916e-80

MucP ; Cell membrane Hydrolase Metal-binding Metalloprotease Transmembrane Zinc

Pubmed 17470813

 

prodomImg

pubmed

1

417

S=659 I=37 E=4.95208e-71

Regulator of sigma E protease EC=3.4.24.- ; Cell inner membrane Hydrolase Metal-binding Metalloprotease Transmembrane Zinc

Pubmed 11274153

 

prodomImg

pubmed

3

445

S=635 I=32 E=5.0706e-68

ORF3 ; Cell membrane Hydrolase Metal-binding Metalloprotease Transmembrane Zinc

Pubmed 9284140

 

prodomImg

pubmed

3

445

S=619 I=32 E=3.89708e-66

ORF3 ; Cell membrane Hydrolase Metal-binding Metalloprotease Transmembrane Zinc

Pubmed 9284140

 

prodomImg

sp_Pdown

sp|Q9PEI1|Y1047_XYLFA

1

444

S=1427 I=64 E=3.45432e-164

Putative zinc metalloprotease XF_1047 EC=3.4.24.- ; Cell inner membrane Hydrolase Metal-binding Transmembrane

sp_Pdown

sp|Q87EI0|Y327_XYLFT

1

444

S=1424 I=64 E=8.11783e-164

Putative zinc metalloprotease PD_0327 EC=3.4.24.- ; Cell inner membrane Hydrolase Metal-binding Transmembrane

sp_Pdown

sp|Q9HXY3|Y3649_PSEAE

12

442

S=737 I=42 E=1.27799e-80

Putative zinc metalloprotease PA3649 EC=3.4.24.- ; Cell inner membrane Hydrolase Metal-binding Transmembrane

sp_Pdown

sp|Q8Z9A4|RSEP_SALTI

11

417

S=696 I=39 E=1.26162e-75

Regulator of sigma E protease EC=3.4.24.- ; Cell inner membrane Hydrolase Metal-binding Metalloprotease Transmembrane Zinc

sp_Pdown

sp|Q8ZRP1|RSEP_SALTY

11

417

S=695 I=39 E=1.61046e-75

Regulator of sigma E protease EC=3.4.24.- ; Cell inner membrane Hydrolase Metal-binding Metalloprotease Transmembrane Zinc

Iprscan [G3DSA:2.30.42.10]

223

292

-

Iprscan [PTHR22939]

223

426

-

Iprscan IPR008915 [PF02163]

11

441

Peptidase M50

Iprscan IPR001478 [PF00595]

220

255

PDZ/DHR/GLGF

Iprscan IPR001478 [SM00228]

107

185

PDZ/DHR/GLGF

Iprscan IPR001478 [SM00228]

211

279

PDZ/DHR/GLGF

Iprscan IPR004387 [TIGR00054]

6

447

Peptidase M50, putative membrane-associated zinc metallopeptidase

Iprscan IPR001478 [PS50106]

223

253

PDZ/DHR/GLGF

Iprscan [seg]

134

147

-

Iprscan [seg]

370

385

-

Iprscan [seg]

425

437

-

Iprscan [SignalP-NN(euk)]

1

20

-

Iprscan [tmhmm]

7

29

-

Iprscan [tmhmm]

98

120

-

Iprscan [tmhmm]

373

395

-

Iprscan [tmhmm]

424

446

-

PDA2E928

11

214

S=229 I=29 E=3.6245e-20

PD718629

124

176

S=177 I=72 E=5.82546e-14

PD081337

74

123

S=162 I=52 E=4.10341e-12

PD004820

37

79

S=150 I=64 E=1.10775e-10

PD005718

342

417

S=139 I=40 E=2.67004e-09

PDA828N8

342

369

S=127 I=96 E=6.37978e-08

PD479793

186

257

S=107 I=45 E=1.78192e-05

PD695264

266

368

S=105 I=27 E=3.57939e-05

Iprscan IPR001478 [SSF50156]

190

292

PDZ/DHR/GLGF

Iprscan IPR001478 [SSF50156]

103

199

PDZ/DHR/GLGF

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rBpGywPj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

98 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr30830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr30830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr30830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrPxgk4/XFF4834R_chr30830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.