Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr18220rraAXFF4834R_chr18220probable ribonuclease activity regulator protein RraA
  2. XFF4834R_chr31710XFF4834R_chr34260700_3641197_r3_XFF4834R-XFF4834R_chr31710XFF4834R_chr31710putative adenylate cyclase family

rraA XFF4834R_chr18220
XFF4834R_chr18210
XFF4834R_chr18210
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18230
XFF4834R_chr18230
ID rraA
AC XFF4834R_chr18220
LT XFF4834R_chr18220
OR XFF4834R_chr from 2082645 to 2083145 on strand +
DE probable ribonuclease activity regulator protein RraA
IP Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase; Ribonuclease E inhibitor RraA
CL 3.1.3.3 Inhibition / activation of enzymes GO:0004857 GO:0008047
EC
GO InterPro
Biological Process: regulation of RNA metabolic process (GO:0051252)
Molecular Function: ribonuclease inhibitor activity (GO:0008428)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100408)
MW 17511.9 Da
SQ 166 aa
 
........10........20........30........40........50
| | | | |
MTWTTPDLCDRYPEATIAEPLFRHFGGRTAFAGPMVTVRCFEDNSRVREL
AATPGDGRVLVVDGQGSLKHALLGDQIAANAVANGWAGVLIHGCVRDVEM
LATLPLGVLALAACPRRTERRDLGDVDVPVNFAGVPFVPGHWLYADANGV
LVAPQPLALDGAGGSI
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one n2Vqh6Az)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

173 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr18220.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr18220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr18220.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr18220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr34260700_3641197_r3_XFF4834R-XFF4834R_chr31710 XFF4834R_chr31710
XFF4834R_chr31700
XFF4834R_chr31700
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31720
XFF4834R_chr31720
ID XFF4834R_chr34260700_3641197_r3_XFF4834R-XFF4834R_chr31710
AC XFF4834R_chr31710
LT XFF4834R_chr31710
OR XFF4834R_chr from 3640700 to 3641197 on strand -
DE putative adenylate cyclase family
IP Adenylate cyclase
CL 3.1.3.3 Inhibition / activation of enzymes GO:0004857 GO:0008047
EC
GO InterPro
Biological Process: cAMP biosynthetic process (GO:0006171)
Molecular Function: adenylate cyclase activity (GO:0004016)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101105)
MW 18539.8 Da
SQ 165 aa
 
........10........20........30........40........50
| | | | |
MPLEIERKFLVTGDGWRDAAHAVIPMAQGYINDQAALRSGMQHASVRVRI
QGESAFLNLKSREVGHTRQEFEYPIPLADARALLALCVGGLIDKRRHLVA
YQGHVWEVDEFLGDNAGLIVAEIELERPDEAFATPEWVGTEVTDDVRYYN
LALASHPFKQWNGDL
XFF4834R

NP_641665.1 lcl|XAC1330-XAC1330

1

165

S=860 I=98 E=1.63247e-97

hypothetical protein

XFF4834R

YP_363113.1 lcl|XCV1382

1

165

S=784 I=96 E=2.14165e-88

putative adenylate cyclase family protein

XFF4834R

NP_636653.1 lcl|XCC1279

1

162

S=729 I=83 E=1.19757e-81

hypothetical protein

XFF4834R

lcl|XALc_2536

1

164

S=692 I=77 E=3.42781e-77

conserved hypothetical protein

Iprscan IPR012042 [PIRSF016487]

1

165

Uncharacterised conserved protein UCP016487, CYTH domain-containing

Iprscan IPR008172 [PF01928]

2

155

Adenylate cyclase

PD826653

49

165

S=164 I=38 E=2.46661e-12

PD027929

1

75

S=159 I=47 E=7.66207e-12

PD057268

75

122

S=155 I=63 E=2.83349e-11

PD026334

123

161

S=131 I=54 E=2.13829e-08

PD757088

89

157

S=124 I=44 E=1.65918e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one S5AEEwym)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr31710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr31710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr31710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY9ITWt/XFF4834R_chr31710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.