Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr15270XFF4834R_chr16390360_1755274_f2_XFF4834R-XFF4834R_chr15270XFF4834R_chr15270putative dinitrogenase reductase activating glycohydrolase
  2. XFF4834R_chr17020sufDXFF4834R_chr17020probable cysteine desulfurase activator complex subunit SufD component of SufBCD complex
  3. XFF4834R_chr17040sufBXFF4834R_chr17040probable cysteine desulfurase activator complex subunit SufB component of SufBCD complex

XFF4834R_chr16390360_1755274_f2_XFF4834R-XFF4834R_chr15270 XFF4834R_chr15270
XFF4834R_chr15260
XFF4834R_chr15260
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15280
XFF4834R_chr15280
ID XFF4834R_chr16390360_1755274_f2_XFF4834R-XFF4834R_chr15270
AC XFF4834R_chr15270
LT XFF4834R_chr15270
OR XFF4834R_chr from 1754360 to 1755274 on strand +
DE putative dinitrogenase reductase activating glycohydrolase
IP ADP-ribosylation/Crystallin J1
CL 3.1.3.2 Covalent modification, demodification, maturation GO:0006464 GO:0016485
EC
GO InterPro


Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100730)
MW 31972.4 Da
SQ 304 aa
 
........10........20........30........40........50
| | | | |
MTDAARRARFRGCLLGLAVGDALGTTLEFCAPGSFTPIDDMRGGGPFALR
AGQWTDDTSMALCLAHSLLHRQGFDPADQMNRYCNWYQHGYLSSTGACFD
IGATVRQALERYLDGGPAFGGSTDPRSAGNGSLMRLAPVAMYYAHCPDQL
ADRAADSSRTTHAAAEALDACRLFAVQLRAALLGGTRDQVLHAQPETSLT
PAVHALAIRDHAAVPAAQIRGTGYVIDSLSAALWCFATTDTFADAVLRAA
NLGDDADTTAAICGQLAGAFYGIDGIPAAWRERAQDAAEIVALADRLYAA
ASVA
XFF4834R

NP_643414.1 lcl|draG-XAC3105

6

304

S=1411 I=90 E=6.73884e-164

dinitrogenase reductase activationg glycohydrolase

XFF4834R

NP_638276.1 lcl|draG-XCC2928

1

303

S=1323 I=85 E=3.26665e-153

dinitrogenase reductase activating glycohydrolase

XFF4834R

YP_364967.1 lcl|XCV3236

141

304

S=684 I=84 E=6.77249e-76

putative ADP-ribosylglycohydrolase (fragment)

XFF4834R

YP_364968.1 lcl|XCV3237

6

118

S=573 I=95 E=2.37179e-62

putative ADP-ribosylglycohydrolase (fragment)

pubmed

1

301

S=306 I=32 E=1.8831e-28

Dinitrogenase reductase activating glycohydrolase

Pubmed 8621068

 

prodomImg

pubmed

1

289

S=305 I=33 E=2.91205e-28

ADP-ribosyl-[dinitrogen reductase] glycohydrolase EC=3.2.2.24 ; fixation

Pubmed 2506427

 

prodomImg

pubmed

1

301

S=299 I=33 E=1.56673e-27

Dinitrogenase reductase activating glycohydrolase

Pubmed 1577701

 

prodomImg

pubmed

9

303

S=291 I=33 E=1.33806e-26

Dinitrogenase reductase activationg glycohydrolase

Pubmed 8277250

 

prodomImg

pubmed

1

299

S=289 I=31 E=2.5508e-26

Dinitrogenase reductase-activating glycohydrolase

Pubmed 9429775

 

prodomImg

sp_Pdown

sp|P14300|DRAG_RHORU

1

289

S=305 I=33 E=2.00131e-28

ADP-ribosyl-[dinitrogen reductase] glycohydrolase EC=3.2.2.24 ; fixation

sp_Pdown

sp|O28550|Y1724_ARCFU

9

298

S=236 I=30 E=3.78978e-20

Uncharacterized protein AF_1724 EC=3.2.2.- ; Hydrolase

sp_Pdown

sp|Q58588|Y1187_METJA

7

302

S=226 I=26 E=7.47478e-19

Uncharacterized protein MJ1187 EC=3.2.2.- ; Hydrolase

sp_Pdown

sp|Q5UQA6|ADPRM_MIMIV

9

280

S=185 I=27 E=5.93384e-14

Putative ADP-ribosyl glycohydrolase L543 EC=3.2.2.- ; Virus reference strain

sp_Pdown

sp|P76418|YEGU_ECOLI

6

281

S=147 I=29 E=2.34506e-09

Uncharacterized protein yegU EC=3.2.2.- ; Hydrolase

Iprscan [PTHR16222]

1

303

-

Iprscan IPR005502 [PF03747]

12

280

ADP-ribosylation/Crystallin J1

Iprscan [SignalP-NN(euk)]

1

24

-

PDA1I5S3

141

233

S=262 I=58 E=2.97777e-24

PD606437

61

142

S=238 I=58 E=2.4306e-21

PDA1S884

1

37

S=168 I=89 E=6.19091e-13

PDA1I6F5

38

73

S=141 I=75 E=1.37729e-09

PD684320

12

70

S=131 I=51 E=2.05514e-08

PD008654

234

286

S=126 I=53 E=7.93871e-08

PD716287

126

191

S=116 I=44 E=1.23737e-06

PDA4A2F1

1

37

S=103 I=51 E=5.30252e-05

Iprscan IPR005502 [SSF101478]

3

299

ADP-ribosylation/Crystallin J1

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one m1n2Wjws)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr15270.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr15270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr15270.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr15270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
sufD XFF4834R_chr17020
XFF4834R_chr17010
XFF4834R_chr17010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17030
XFF4834R_chr17030
ID sufD
AC XFF4834R_chr17020
LT XFF4834R_chr17020
OR XFF4834R_chr from 1952962 to 1954224 on strand -
DE probable cysteine desulfurase activator complex subunit SufD component of SufBCD complex
IP SUF system FeS cluster assembly, SufBD
CL 3.1.3.2 Covalent modification, demodification, maturation GO:0006464 GO:0016485
EC
GO InterPro
Biological Process: iron-sulfur cluster assembly (GO:0016226)
Molecular Function: protein binding (GO:0005515)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100730)
MW 44875.1 Da
SQ 420 aa
 
........10........20........30........40........50
| | | | |
MSALLDSLARGFSGSDARRAELDAALQTGLPGPRAEAWKYTSLRQLERRS
FQPAPLVPTLVDAAALDDIPSPRLVLVNGRPSEALSDLSTLPEGVQLDTL
SASLAASDQAQQLLGRRFDGSDEVFARLNAALADEGVLVRVHAGAQIELP
LHLVFVGVAGEQDLSWHHRHLIELRAGAALQVIEHHLHVGDAAHLENSVM
HVHLAQGAALSHARVQAGSAHATSLLRTDAVLARDARYQRVDLELGAGLS
RHELNVRLEGNNAQLTANGVLLGNGRRHVDTRLGIEHIARDTACELVWRG
VGADRSRVVFHGGIRIRAGADGTDARLSNKNLLLSSNAEIDTQPVLVIDA
DEVQAAHGATVGQLDDNALFYLRSRGLPQQQAQRLLSAAFCHEPLRVLPA
ALSAVLALQLDRALNSAGVA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr17040 lcl|sufB-XFF4834R_chr17040

122

393

S=175 I=23 E=1.40955e-14

component of SufBCD complex

XFF4834R

NP_643246.1 lcl|ynhC-XAC2937

1

420

S=1851 I=89 E=0

ABC transporter permease

XFF4834R

YP_364812.1 lcl|sufD-XCV3081

1

420

S=1821 I=87 E=0

ABC transporter-associated protein involved in Fe-S cluster assembly

XFF4834R

NP_638116.1 lcl|ynhC-XCC2768

1

420

S=1622 I=78 E=0

ABC transporter permease

XFF4834R

lcl|sufD-XALc_1028

1

419

S=1285 I=63 E=1.63081e-148

probable abc transporter-associated involved in fe-s cluster assembly abc transporter protein

XFF4834R

YP_364810.1 lcl|sufB-XCV3079

122

393

S=180 I=23 E=1.45816e-14

cysteine desulfurase activator complex subunit SufB

XFF4834R

NP_643244.1 lcl|ynhE-XAC2935

122

393

S=176 I=23 E=4.49018e-14

cysteine desulfurase activator complex subunit SufB

XFF4834R

NP_638114.1 lcl|ynhE-XCC2766

122

393

S=172 I=23 E=1.38268e-13

cysteine desulfurase activator complex subunit SufB

XFF4834R

lcl|sufB-XALc_1031

122

393

S=156 I=22 E=1.15949e-11

probable abc transporter-associated protein involved in fe-s cluster assembly

pubmed

15

393

S=438 I=32 E=3.22533e-44

SufD protein

Pubmed 11251816

 

prodomImg

pubmed

22

393

S=393 I=31 E=8.83071e-39

FeS assembly protein SufD SufD

Pubmed 14761990

 

prodomImg

pubmed

18

393

S=240 I=23 E=3.24511e-20

Protein ABCI7, chloroplastic ; Plastid Transit peptide

Pubmed 11346655

 

prodomImg

pubmed

121

392

S=225 I=24 E=1.88687e-18

SufB

Pubmed 15066816

 

prodomImg

pubmed

115

391

S=213 I=25 E=5.6065e-17

Putative iron-regulated ABC transporter component ABC1MC1

Pubmed 17322329

 

prodomImg

sp_Pdown

sp|P77689|SUFD_ECOLI

27

393

S=412 I=33 E=3.24086e-41

FeS cluster assembly protein sufD

sp_Pdown

sp|Q55792|Y076_SYNY3

30

393

S=346 I=28 E=3.21928e-33

UPF0051 protein slr0076

sp_Pdown

sp|Q9LQK7|AB7I_ARATH

18

393

S=240 I=23 E=2.20806e-20

Protein ABCI7, chloroplastic ; Plastid Transit peptide

sp_Pdown

sp|O32165|SUFD_BACSU

128

391

S=227 I=26 E=8.30227e-19

FeS cluster assembly protein sufD

sp_Pdown

sp|O32162|SUFB_BACSU

121

390

S=208 I=23 E=1.59389e-16

FeS cluster assembly protein sufB

Iprscan IPR000825 [PF01458]

162

390

SUF system FeS cluster assembly, SufBD

Iprscan IPR011542 [TIGR01981]

30

407

SUF system FeS cluster assembly, SufD

Iprscan [seg]

96

114

-

Iprscan [seg]

327

337

-

Iprscan [seg]

394

410

-

PD003219

15

393

S=377 I=29 E=3.03381e-38

PD463035

17

204

S=155 I=27 E=2.83964e-11

PDA1H7T3

338

393

S=109 I=37 E=9.33686e-06

Iprscan [SSF101960]

15

413

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7cL3j36r)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

29 hits
swiss-prot

Swiss-Prot ncbi-blastp

37 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
sufB XFF4834R_chr17040
XFF4834R_chr17030
XFF4834R_chr17030
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17050
XFF4834R_chr17050
ID sufB
AC XFF4834R_chr17040
LT XFF4834R_chr17040
OR XFF4834R_chr from 1955097 to 1956554 on strand -
DE probable cysteine desulfurase activator complex subunit SufB component of SufBCD complex
IP SUF system FeS cluster assembly, SufBD
CL 3.1.3.2 Covalent modification, demodification, maturation GO:0006464 GO:0016485
EC
GO InterPro
Biological Process: iron-sulfur cluster assembly (GO:0016226)
Molecular Function: protein binding (GO:0005515)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100730)
MW 53910.7 Da
SQ 485 aa
 
........10........20........30........40........50
| | | | |
MATELAPPQNAQILERLGRRYDAGFITEIESDSLPPGLDEDVIRALSAKK
DEPQWMTDWRLEAYRHWLKMPMPEWAKLQISAIDFQALSYYSAPKGPKYA
SLDEVPKELLDTYDKLGVPLHERAKLAGVAVDAVFDSVSVGTTFRKELAE
KGVIFCSMSEAIKEHPEIVRQYLGSVVPVGDNYFAALNSAVFSDGSFVFI
PKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVSYLEGCTAPMRDE
NQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECRGA
RSKVTWTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTK
MIHIGKRTKSKIVSKGISAGRGQNTYRGQVKVDRNADGARNYTQCDSLLI
GKQCGAHTFPYIEVKNPGATVEHEATTSKISDDQLFYCRARGISQEDAVS
LIVDGFCKQVFRELPMEFAVEAKKLLEVSLEGSVG
XFF4834R

XFF4834R_chr17020 lcl|sufD-XFF4834R_chr17020

151

475

S=219 I=24 E=8.65946e-20

component of SufBCD complex

XFF4834R

NP_643244.1 lcl|ynhE-XAC2935

1

485

S=2528 I=97 E=0

cysteine desulfurase activator complex subunit SufB

XFF4834R

YP_364810.1 lcl|sufB-XCV3079

1

485

S=2522 I=97 E=0

cysteine desulfurase activator complex subunit SufB

XFF4834R

NP_638114.1 lcl|ynhE-XCC2766

1

485

S=2488 I=95 E=0

cysteine desulfurase activator complex subunit SufB

XFF4834R

lcl|sufB-XALc_1031

9

485

S=2332 I=89 E=0

probable abc transporter-associated protein involved in fe-s cluster assembly

XFF4834R

NP_638116.1 lcl|ynhC-XCC2768

152

481

S=238 I=25 E=1.45765e-21

ABC transporter permease

XFF4834R

lcl|sufD-XALc_1028

152

465

S=230 I=25 E=1.2668e-20

probable abc transporter-associated involved in fe-s cluster assembly abc transporter protein

XFF4834R

YP_364812.1 lcl|sufD-XCV3081

151

475

S=228 I=25 E=2.70478e-20

ABC transporter-associated protein involved in Fe-S cluster assembly

XFF4834R

NP_643246.1 lcl|ynhC-XAC2937

151

465

S=221 I=24 E=1.79392e-19

ABC transporter permease

pubmed

10

485

S=1701 I=64 E=0

FeS assembly protein SufB SufB

Pubmed 14761990

 

prodomImg

pubmed

15

485

S=1602 I=61 E=0

UPF0051 protein ycf24 ; Chloroplast Plastid

Pubmed 9929392

 

prodomImg

pubmed

17

485

S=1601 I=61 E=0

Iron-sulfur cluster formation ABC transporter ; Chloroplast Plastid

Pubmed 17522086

 

prodomImg

pubmed

17

485

S=1596 I=60 E=0

ABC transporter subunit ; Chloroplast

Pubmed 15638458

 

prodomImg

pubmed

10

485

S=1584 I=59 E=0

Iron-sulfur cluster formation ABC transporter ; Chloroplast Plastid

Pubmed 17252281

 

prodomImg

sp_Pdown

sp|Q55790|Y074_SYNY3

17

485

S=1723 I=66 E=0

UPF0051 protein slr0074

sp_Pdown

sp|P48260|YCF24_CYAPA

8

485

S=1622 I=61 E=0

UPF0051 protein ycf24 ; Cyanelle Plastid

sp_Pdown

sp|Q1XDP7|YCF24_PORYE

9

485

S=1605 I=60 E=0

UPF0051 protein ycf24 ; Chloroplast Plastid

sp_Pdown

sp|O78473|YCF24_GUITH

15

485

S=1602 I=61 E=0

UPF0051 protein ycf24 ; Chloroplast Plastid

sp_Pdown

sp|P51240|YCF24_PORPU

17

485

S=1600 I=61 E=0

UPF0051 protein ycf24 ; Chloroplast Plastid

Iprscan IPR000825 [PF01458]

221

456

SUF system FeS cluster assembly, SufBD

Iprscan IPR010231 [TIGR01980]

19

476

SUF system FeS cluster assembly, SufB

Iprscan [seg]

128

141

-

PD003219

148

476

S=984 I=57 E=1.19525e-111

PDA1G0A5

230

322

S=420 I=80 E=2.47505e-43

PDA1H7T3

385

484

S=226 I=42 E=8.08685e-20

PD005891

184

229

S=214 I=80 E=2.05387e-18

PD815780

38

115

S=190 I=47 E=1.84521e-15

PDA1L300

1

37

S=164 I=81 E=2.70125e-12

PD583482

152

182

S=136 I=74 E=6.90907e-09

PD581536

324

385

S=134 I=45 E=1.14561e-08

PDA1V626

81

107

S=128 I=89 E=5.95232e-08

PDA8B4K8

142

186

S=112 I=38 E=5.73872e-06

Iprscan [SSF101960]

40

483

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5N6TA4Db)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

66 hits
swiss-prot

Swiss-Prot ncbi-blastp

43 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17040.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17040.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBX1wbc4/XFF4834R_chr17040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.