Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06190XFF4834R_chr06370155_0699084_r1_XFF4834R-XFF4834R_chr06190XFF4834R_chr06190hypothetical protein

XFF4834R_chr06370155_0699084_r1_XFF4834R-XFF4834R_chr06190 XFF4834R_chr06190
XFF4834R_chr_0673
XFF4834R_chr_0673
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06200
XFF4834R_chr06200
ID XFF4834R_chr06370155_0699084_r1_XFF4834R-XFF4834R_chr06190
AC XFF4834R_chr06190
LT XFF4834R_chr06190
OR XFF4834R_chr from 698155 to 699084 on strand -
DE hypothetical protein
IP GAF
CL 3.1.2.5 Action unknown
EC
GO InterPro


Curated
PM
AN GAF domains bind to small molecules; may bind cyclic nucleotides, but most ligands are not well known. Domain present in phytochromes and cGMP-specific phosphodiesterases.
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20100819)
MW 33927.1 Da
SQ 309 aa
 
........10........20........30........40........50
| | | | |
MKDMPVADEASRQHVLDGYRIVDSLPEDTYQDVVQVAASLCDTPIALMSL
VDRDRQWFKAQLGLGVQQTDRSQAVCDHAIRSPEQLMEVPDLREDSRFAD
ISVVTGDTGARFYAGMPLVTSDGVALGTVCVLDTEPRTLTELQRTGLQAL
ARVAMRLLDERKRELQLERDAILQPVAPVASQAVADTGYHLVILEVQELA
ALAERQSERLLGRNLQQLDQALAALVQGPGNSIDRVTDSAEFIAVLRGPD
AERTLQSLREIAQQQHALGLTVLLGQAQSTGPDEPIGQVFLRAEVALSAE
KDRYRQRLA
XFF4834R

XFF4834R_chr24300 lcl|XFF4834R_chr26520356_2803441_f2_XFF4834R-XFF4834R_chr24300

7

172

S=389 I=46 E=1.18768e-40

XFF4834R

XFF4834R_chr13120 lcl|XFF4834R_chr13870082_1495317_r1_XFF4834R-XFF4834R_chr13120

9

162

S=353 I=49 E=2.75765e-36

XFF4834R

XFF4834R_chr18180 lcl|XFF4834R_chr19420624_2079694_f2_XFF4834R-XFF4834R_chr18180

3

161

S=333 I=44 E=7.76976e-34

XFF4834R

XFF4834R_chr19240 lcl|XFF4834R_chr20630458_2204527_r3_XFF4834R-XFF4834R_chr19240

5

137

S=314 I=49 E=1.39116e-31

XFF4834R

XFF4834R_chr06210 lcl|XFF4834R_chr06410629_0705370_f2_XFF4834R-XFF4834R_chr06210

4

165

S=294 I=40 E=3.81845e-29

XFF4834R

XFF4834R_chr_4558 lcl|XFF4834R_chr_4961080_4961583_r1_XFF4834R-XFF4834R_chr_4558

9

140

S=238 I=42 E=2.39146e-22

XFF4834R

NP_640961.1 lcl|phS-XAC0608

1

309

S=1436 I=92 E=6.55264e-167

histidine kinase-response regulator hybrid protein

XFF4834R

YP_362396.1 lcl|XCV0665

1

309

S=1391 I=89 E=1.56046e-161

hypothetical protein

XFF4834R

NP_638871.1 lcl|phS-XCC3525

1

309

S=1204 I=77 E=8.02991e-139

histidine kinase/response regulator hybrid protein

XFF4834R

lcl|XALc_2971

1

306

S=912 I=61 E=1.63633e-103

hypothetical protein.

XFF4834R

NP_637667.1 lcl|XCC2313

1

172

S=432 I=51 E=2.70013e-45

hypothetical protein

XFF4834R

YP_364354.1 lcl|XCV2623

7

172

S=393 I=47 E=1.27037e-40

putative sensor protein

XFF4834R

lcl|XALc_2050

8

162

S=393 I=50 E=1.36215e-40

hypothetical sensor protein

XFF4834R

NP_642761.1 lcl|XAC2446-XAC2446

7

172

S=382 I=46 E=3.39973e-39

hypothetical protein

XFF4834R

lcl|XALc_2520

8

162

S=366 I=48 E=2.35334e-37

probable two component system sensor protein

XFF4834R

NP_643643.1 lcl|XAC3335-XAC3335

9

162

S=353 I=49 E=1.10999e-35

sensor histidine kinase

XFF4834R

YP_365184.1 lcl|XCV3453

9

162

S=348 I=48 E=4.4788e-35

putative two-component system sensor histidine kinase

XFF4834R

lcl|XALc_1693

9

162

S=346 I=47 E=6.23805e-35

putative two component system sensor -response regulator hybrid protein

XFF4834R

NP_638524.1 lcl|XCC3178

9

162

S=346 I=47 E=6.63062e-35

sensor histidine kinase

XFF4834R

NP_643119.1 lcl|XAC2810-XAC2810

3

161

S=335 I=45 E=1.49052e-33

hypothetical protein

XFF4834R

YP_364702.1 lcl|XCV2971

3

161

S=332 I=44 E=3.92318e-33

putative sensor protein

XFF4834R

YP_363556.1 lcl|XCV1825

5

137

S=326 I=50 E=1.9345e-32

putative phosphodiesterase

XFF4834R

NP_639558.1 lcl|XCC4224

7

169

S=315 I=47 E=4.31087e-31

hypothetical protein

XFF4834R

NP_642122.1 lcl|XAC1795-XAC1795

5

137

S=313 I=49 E=6.21725e-31

hypothetical protein

XFF4834R

lcl|XALc_1211

8

159

S=300 I=45 E=2.61824e-29

hypothetical protein

XFF4834R

YP_362398.1 lcl|XCV0667

4

165

S=300 I=41 E=2.75885e-29

putative sensor protein

XFF4834R

NP_637143.1 lcl|XCC1777

4

155

S=296 I=44 E=8.42171e-29

hypothetical protein

XFF4834R

NP_640963.1 lcl|XAC0610-XAC0610

4

165

S=296 I=40 E=8.6449e-29

histidine kinase-response regulator hybrid protein

XFF4834R

NP_638869.1 lcl|XCC3523

4

165

S=285 I=39 E=1.5764e-27

histidine kinase/response regulator hybrid protein

XFF4834R

YP_366201.1 lcl|XCV4470

20

171

S=275 I=46 E=2.63455e-26

putative signal transduction protein

XFF4834R

NP_644652.1 lcl|XAC4358-XAC4358

7

171

S=268 I=43 E=1.97419e-25

hypothetical protein

XFF4834R

NP_639076.1 lcl|XCC3730

8

171

S=252 I=37 E=1.83811e-23

histidine kinase/response regulator hybrid protein

pubmed

9

164

S=260 I=38 E=6.68184e-23

Stomatin like protein (slp)

Pubmed 9782511

 

prodomImg

pubmed

27

159

S=236 I=35 E=5.45404e-20

Limonene hydroxylase CD6-1

Pubmed 18051329

 

prodomImg

pubmed

21

153

S=233 I=38 E=1.38636e-19

Putative uncharacterized protein ; Plasmid

Pubmed 16251312

 

prodomImg

pubmed

23

164

S=207 I=37 E=1.82791e-16

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Nucleotide-binding Phosphoprotein Receptor Transferase Two-component regulatory system

Pubmed 19538504

 

prodomImg

pubmed

22

151

S=188 I=28 E=3.571e-14

Putative sensory histidine protein kinase

Pubmed 10784058

 

prodomImg

Iprscan IPR003018 [SM00065]

25

168

GAF

Iprscan [seg]

174

185

-

Iprscan [seg]

215

227

-

PD602192

169

309

S=514 I=77 E=8.97199e-55

PD328657

47

114

S=187 I=51 E=3.26808e-15

PDA3G2H0

86

159

S=126 I=34 E=9.24986e-08

PDA0A7C1

91

171

S=122 I=36 E=2.31056e-07

PD689538

73

166

S=117 I=32 E=1.03513e-06

Iprscan [SSF55781]

26

160

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one yMIA7WT9)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSCPES_/XFF4834R_chr06190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSCPES_/XFF4834R_chr06190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSCPES_/XFF4834R_chr06190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSCPES_/XFF4834R_chr06190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.