Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr20190rfpFXFF4834R_chr20190enoyl coA hydratase protein RpfF
  2. XFF4834R_chr23730XFF4834R_chr25920883_2742848_r2_XFF4834R-XFF4834R_chr23730XFF4834R_chr23730putative N-acylhomoserine lactonase
  3. XFF4834R_chr39700xanB2XFF4834R_chr39700Putative pteridine-dependent dioxygenase

rfpF XFF4834R_chr20190
XFF4834R_chr20180
XFF4834R_chr20180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20200
XFF4834R_chr20200
ID rfpF
AC XFF4834R_chr20190
LT XFF4834R_chr20190
OR XFF4834R_chr from 2316528 to 2317397 on strand -
DE enoyl coA hydratase protein RpfF
IP Crotonase, core
CL 3.1.2.4.4 Quorum sensing GO:0009370 GO:0009369 GO:0009372
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN publi fonctionnelle Xcc et xoo. the rpfF gene is involved in production of a diffusible extracellular factor (DSF) that positively regulates (quorum sensing) synthesis of virulence-associated functions like extracellular polysaccharide (EPS) and extracellular enzymes.
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120313)
MW 31647.2 Da
SQ 289 aa
 
........10........20........30........40........50
| | | | |
MSAVQPFIRTNIGSTLRIVEEPQRDVYWIHMHADLAVNPGRACFSTRLVD
DITGYQSNLGQRLNNAGVLAPHVVLASDSDVFNLGGDLALFCQLIREGDR
ARLLDYAQRCVRGVHAFHVGLGARAHSIALVQGNALGGGFEAALSCHTIV
AEEGVMMGLPEVLFDLFPGMGAYSFMCQRVSAQLAQKIMLEGNLYSAEEL
LGMGLVDRVVPRGQGVAAVEQVIRESKRTPHAWAAMQQVREMTTAVPLEE
MMRITEIWVDTAMQLGEKSLRTMDRLVRAQSRRSGLDAG
XFF4834R

XFF4834R_chr31920 lcl|paaF-XFF4834R_chr31920

73

243

S=170 I=32 E=4.18597e-14

enoyl-CoA hydratase-isomerase

XFF4834R

XFF4834R_chr31830 lcl|fadJ-XFF4834R_chr31830

73

209

S=140 I=32 E=1.4152e-10

fused enoyl-CoA hydratase and epimerase and isomerase/3-hydroxyacyl-CoA dehydrogenase

XFF4834R

XFF4834R_chr29290 lcl|XFF4834R_chr31820199_3365981_f3_XFF4834R-XFF4834R_chr29290

128

210

S=125 I=36 E=1.04128e-08

XFF4834R

XFF4834R_chr08860 lcl|XFF4834R_chr09440000_1028827_r3_XFF4834R-XFF4834R_chr08860

64

211

S=106 I=27 E=2.20029e-06

XFF4834R

XFF4834R_chr32960 lcl|XFF4834R_chr35680747_3795517_f2_XFF4834R-XFF4834R_chr32960

73

210

S=93 I=29 E=7.25886e-05

XFF4834R

YP_363651.1 lcl|rpfF-XCV1920

1

289

S=1513 I=98 E=2.87458e-176

enoyl-CoA hydratase

XFF4834R

NP_637222.1 lcl|rpfF-XCC1857

1

289

S=1504 I=97 E=2.97411e-175

enoyl-CoA hydratase

XFF4834R

NP_642205.1 lcl|rpfF-XAC1879

14

286

S=789 I=56 E=1.43819e-88

enoyl-CoA hydratase

XFF4834R

lcl|rpfF-XALc_1347

14

284

S=736 I=50 E=3.54354e-82

probable enoyl-coa hydratase protein

XFF4834R

YP_363096.1 lcl|XCV1365

73

243

S=168 I=32 E=2.7373e-13

enoyl-CoA hydratase

XFF4834R

NP_641649.1 lcl|paaF-XAC1314

73

243

S=167 I=32 E=3.58678e-13

enoyl-CoA hydratase

XFF4834R

NP_636636.1 lcl|paaF-XCC1262

73

243

S=165 I=31 E=6.10494e-13

enoyl-CoA hydratase

XFF4834R

lcl|XALc_1063

128

258

S=158 I=33 E=3.49126e-12

hypothetical enoyl-coa hydratase/isomerase; protein

XFF4834R

NP_636640.1 lcl|fadB-XCC1266

73

208

S=143 I=32 E=2.82736e-10

3-hydroxyacyl-CoA dehydrogenase

XFF4834R

lcl|fadJ-XALc_2548

73

209

S=143 I=31 E=2.85212e-10

probable fatty acid oxidation complex, alpha subunit fadj protein

XFF4834R

YP_363100.1 lcl|fadB-XCV1369

73

209

S=140 I=32 E=5.25077e-10

fatty oxidation complex alpha subunit

XFF4834R

NP_641653.1 lcl|fadB-XAC1318

73

209

S=140 I=32 E=5.67939e-10

3-hydroxyacyl-CoA dehydrogenase

XFF4834R

NP_636905.1 lcl|crt-XCC1534

128

210

S=133 I=39 E=4.56327e-09

3-hydroxybutyryl-CoA dehydratase

XFF4834R

lcl|XALc_1985

128

210

S=130 I=37 E=9.82853e-09

putative 3-hydroxybutyryl-coa dehydratase protein

XFF4834R

YP_363356.1 lcl|XCV1625

128

210

S=129 I=37 E=1.29914e-08

3-hydroxybutyryl-CoA dehydratase

XFF4834R

NP_641916.1 lcl|crt-XAC1584

128

210

S=129 I=37 E=1.33357e-08

3-hydroxybutyryl-CoA dehydratase

XFF4834R

lcl|XALc_3045

127

230

S=112 I=28 E=1.51736e-06

putative enoyl-coa hydratase protein

XFF4834R

NP_636201.1 lcl|fadB-XCC0810

64

211

S=106 I=28 E=7.28886e-06

p-hydroxycinnamoyl CoA hydratase/lyase

XFF4834R

YP_362649.1 lcl|paaF-XCV0918

64

211

S=106 I=27 E=7.54754e-06

p-hydroxycinnamoyl CoA hydratase/lyase

XFF4834R

NP_641235.1 lcl|fadB-XAC0883

64

211

S=106 I=27 E=8.23513e-06

p-hydroxycinnamoyl CoA hydratase/lyase

pubmed

1

289

S=1504 I=97 E=1.22217e-173

RpfF protein

Pubmed 9179849

 

prodomImg

pubmed

1

289

S=1467 I=95 E=3.59095e-169

RpfF

Pubmed 12036277

 

prodomImg

pubmed

1

288

S=785 I=53 E=1.81992e-86

Enoyl CoA hydratase

Pubmed 17574998

 

prodomImg

pubmed

73

262

S=182 I=29 E=2.05633e-13

Putative enoyl-CoA hydratase

Pubmed 19854898

 

prodomImg

pubmed

128

258

S=168 I=33 E=9.12478e-12

DpgD protein

Pubmed 15113000,14702401

 

prodomImg

sp_Pdown

sp|Q8DDK6|FADB_VIBVU

73

255

S=168 I=29 E=6.60606e-12

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.3.3.8 EC=5.1.2.3 EC=1.1.1.35 ; metabolism Isomerase Lipid degradation Lyase Multifunctional enzyme NAD

sp_Pdown

sp|Q7MQH9|FADB_VIBVY

73

255

S=168 I=29 E=6.78113e-12

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.3.3.8 EC=5.1.2.3 EC=1.1.1.35 ; metabolism Isomerase Lipid degradation Lyase Multifunctional

sp_Pdown

sp|A4TM82|FADJ_YERPP

73

212

S=165 I=33 E=1.41049e-11

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.1.2.3 EC=1.1.1.35 ; Cytoplasm metabolism Isomerase Lipid degradation Lyase Multifunctional enzyme NAD

sp_Pdown

sp|A7MH81|FADJ_ENTS8

69

230

S=165 I=30 E=1.44786e-11

Fatty acid oxidation complex subunit alpha EC=4.2.1.17 EC=5.1.2.3 EC=1.1.1.35 ; Cytoplasm metabolism Isomerase Lipid degradation Lyase Multifunctional enzyme NAD

sp_Pdown

sp|P94549|FADB_BACSU

38

206

S=165 I=28 E=1.44786e-11

Probable enoyl-CoA hydratase EC=4.2.1.17 ; Fatty acid metabolism Lipid degradation Lyase

Iprscan [G3DSA:3.90.226.10]

18

231

-

Iprscan [PTHR11941]

73

283

-

Iprscan IPR001753 [PF00378]

73

211

Crotonase, core

PDA1M2X0

71

250

S=456 I=47 E=9.7858e-48

PD067592

1

63

S=294 I=83 E=3.98938e-28

PD687001

251

289

S=193 I=97 E=6.21516e-16

PDA3Q912

220

250

S=157 I=97 E=1.39363e-11

Iprscan [SSF52096]

73

285

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hx8WpQtx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

80 hits
swiss-prot

Swiss-Prot ncbi-blastp

254 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr20190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr20190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr20190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr20190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr25920883_2742848_r2_XFF4834R-XFF4834R_chr23730 XFF4834R_chr23730
XFF4834R_chr23720
XFF4834R_chr23720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23740
XFF4834R_chr23740
ID XFF4834R_chr25920883_2742848_r2_XFF4834R-XFF4834R_chr23730
AC XFF4834R_chr23730
LT XFF4834R_chr23730
OR XFF4834R_chr from 2741883 to 2742848 on strand -
DE putative N-acylhomoserine lactonase
IP Beta-lactamase-like
CL 3.1.2.4.4 Quorum sensing GO:0009370 GO:0009369 GO:0009372
EC
GO InterPro
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN pubmed besthits : putative N-acylhomoserine lactonase, this hydrolase is responsible for the degradation of a diffusible signal (N-acylhomoserine lactone, AHL). AHL is involved in quorum sensing of some Gram negative bacteria (ie Pseudomonas, Erwinia carotovora...) but not in the genus Xanthomonas. interprro Beta-lactamase-like : Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [1]. These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 36041 Da
SQ 321 aa
 
........10........20........30........40........50
| | | | |
MRAGCAIGTAHRCATAALQCWPAKRSAPMRVHHLNCISTCPLGGHLMDGR
TPGVLDRGHLCCHCLLVETSAGLVLIDTGFGLRDVAEPRARLSRFFLALV
KPDLREDMTAIRQIQRLGLDPRDVRHIVLTHLDFDHAGGLDDFPHARVHL
MTSERDAALAQRTWMDRQRFRPQQWSTRGQWRTYDGAAGEHWMGLECVRD
LHGLPPELLMVPLPGHTLGHAAVAVHTPERWLLLAGDAYFFHREMDADAP
YCTPGLRAYQWMLEKDRTARLTNQQRLRALRQQHGGEVEVFCSHDVSEFE
RVAGQPARLPSGALLHAPTPQ
XFF4834R

XFF4834R_chr26070 lcl|XFF4834R_chr28560212_3013060_r3_XFF4834R-XFF4834R_chr26070

65

301

S=94 I=26 E=6.74873e-05

XFF4834R

YP_364297.1 lcl|XCV2566

1

321

S=1609 I=96 E=0

metallo-beta-lactamase superfamily protein

XFF4834R

NP_642684.2 lcl|XAC2368-XAC2368

29

321

S=1512 I=99 E=4.1876e-176

hypothetical protein

XFF4834R

NP_637618.2 lcl|XCC2263

29

319

S=1351 I=89 E=1.17342e-156

hypothetical protein

pubmed

51

252

S=164 I=27 E=3.37642e-11

AiiA-like protein

Pubmed 12147491

 

prodomImg

pubmed

30

300

S=163 I=27 E=4.50206e-11

Mlr6805 protein 4-pyridoxolactonase

Pubmed 16226926

 

prodomImg

pubmed

65

228

S=160 I=27 E=9.04339e-11

AhlK

Pubmed 12777494

 

prodomImg

pubmed

65

240

S=159 I=29 E=1.3272e-10

AttM

Pubmed 10786639

 

prodomImg

pubmed

64

252

S=158 I=26 E=1.60783e-10

AHL-lactonase

Pubmed 11916693

 

prodomImg

pubmed

51

252

S=158 I=27 E=1.89751e-10

AHL-lactonase

Pubmed 11916693

 

prodomImg

pubmed

51

252

S=158 I=27 E=1.89751e-10

AiiA-like protein

Pubmed 12147491

 

prodomImg

pubmed

51

252

S=158 I=27 E=1.89751e-10

AiiA-like protein

Pubmed 12147491

 

prodomImg

pubmed

51

252

S=158 I=27 E=1.89751e-10

AiiA-like protein

Pubmed 12147491

 

prodomImg

pubmed

51

252

S=158 I=27 E=1.89751e-10

AiiA-like protein

Pubmed 12147491

 

prodomImg

sp_Pdown

sp|P64982|Y2322_MYCBO

12

300

S=459 I=38 E=4.40959e-47

Uncharacterized protein Mb2322c

sp_Pdown

sp|P64981|Y2300_MYCTU

12

300

S=459 I=38 E=4.40959e-47

Uncharacterized protein Rv2300c/MT2357

Iprscan [G3DSA:3.60.15.10]

56

295

-

Iprscan [PF00753]

61

256

-

Iprscan IPR001279 [SM00849]

61

294

Beta-lactamase-like

PD600722

30

93

S=207 I=62 E=1.25304e-17

PDA1Y2Q7

143

180

S=187 I=95 E=3.91988e-15

PD867719

179

295

S=173 I=42 E=1.59418e-13

PDA0W8J0

239

301

S=156 I=51 E=2.04937e-11

PD643998

49

156

S=135 I=37 E=8.25535e-09

PD644000

1

29

S=133 I=93 E=1.1498e-08

PDA2R8E8

297

321

S=124 I=96 E=1.55879e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ovSQYkRy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr23730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr23730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr23730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr23730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
xanB2 XFF4834R_chr39700
XFF4834R_chr39690
XFF4834R_chr39690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39710
XFF4834R_chr39710
ID xanB2
AC XFF4834R_chr39700
LT XFF4834R_chr39700
OR XFF4834R_chr from 4571002 to 4572009 on strand +
DE Putative pteridine-dependent dioxygenase
IP Endoribonuclease L-PSP/chorismate mutase-like
CL 3.1.2.4.4 Quorum sensing GO:0009370 GO:0009369 GO:0009372
EC
GO InterPro


Curated
PM
AN xanthomonadin biosynthesis orthologous to XOO_4072. This cds is located in between orf 11 and 12 of the pig cluster and encodes DF (diifusible factor, quorum sensing) according to Poplawsky et al 2005 MPP 6 653-657
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120327)
MW 36490.7 Da
SQ 335 aa
 
........10........20........30........40........50
| | | | |
MTASQAQTTHAVRHPRLQVDYVDQTDPAVLLTDPQVLAVFGFGDAAPRLH
DSRYLRVPLQPYQASVLEVWRTDAPVSSGRDGNIAWSSDGHLQFGVIEID
EQDVDIEEAAARAYAEITAFVSNSQTPRLLRIWNYLDAITLGSGDRERYR
QFCVGRARGLGAFDTAQLPAATAVGRCDAERIIQIYWLAAANAGTPLENP
RQVSAYHYPRQYGPQSPSFARAMLPPAGSDMPLLLSGTAAVVGHASMHTG
QLLAQLEETFANFDALLGAARQQAPALPAQFGAGTRLKVYVREREDLPRV
AQALDARFGDAVPRLLLHAVICRDELAVEIDGVHG
XFF4834R

YP_365922.1 lcl|XCV4191

1

335

S=1487 I=87 E=4.34044e-173

putative pteridine-dependent deoxygenase like protein

XFF4834R

NP_644402.2 lcl|rapK-XAC4103

39

335

S=1310 I=86 E=1.31334e-151

pteridine-dependent deoxygenase like protein

XFF4834R

NP_639353.2 lcl|rapK-XCC4014

39

335

S=1232 I=81 E=3.58383e-142

pteridine-dependent deoxygenase like protein

XFF4834R

lcl|XALc_0126

10

335

S=1151 I=69 E=2.52957e-132

probable pteridine-dependent deoxygenase like protein

pubmed

68

333

S=335 I=34 E=6.40409e-32

FkbO

Pubmed 10863099

 

prodomImg

pubmed

63

333

S=329 I=35 E=3.56779e-31

Putative oxidase

Pubmed 18503195

 

prodomImg

pubmed

59

333

S=309 I=31 E=9.05378e-29

Putative pteridine-dependent dioxygenase

Pubmed 9426000

 

prodomImg

pubmed

65

333

S=301 I=32 E=1.05834e-27

Pteridine-dependent dioxygenase

Pubmed 7644502,8635730

 

prodomImg

pubmed

68

333

S=297 I=34 E=3.11997e-27

FK506 oxidase

Pubmed 9780228

 

prodomImg

Iprscan [seg]

96

119

-

Iprscan [seg]

265

280

-

PD876082

36

215

S=362 I=47 E=2.54562e-36

PDA3B0J1

1

35

S=172 I=97 E=2.21025e-13

PD041260

210

332

S=169 I=38 E=5.14912e-13

Iprscan IPR013813 [SSF55298]

200

333

Endoribonuclease L-PSP/chorismate mutase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dqXi7ITx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr39700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr39700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr39700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF27m7_/XFF4834R_chr39700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.