Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10100typAXFF4834R_chr10100probable GTP-BINDING PROTEIN/ELONGATION FACTOR

typA XFF4834R_chr10100
XFF4834R_chr10090
XFF4834R_chr10090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10110
XFF4834R_chr10110
ID typA
AC XFF4834R_chr10100
LT XFF4834R_chr10100
OR XFF4834R_chr from 1143263 to 1145092 on strand -
DE probable GTP-BINDING PROTEIN/ELONGATION FACTOR
IP Translation elongation factor EFG/EF2, C-terminal
CL 3.1.2.4.2 Regulons or multilayer component regulatory systems
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
Molecular Function: GTPase activity (GO:0003924)
Molecular Function: GTP binding (GO:0005525)

Curated
PM
AN In many bacterial species, the translational GTPase TypA acts as a global stress- and virulence regulator and also mediates resistance to the antimicrobial peptide BPI.
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101004)
MW 67307.2 Da
SQ 609 aa
 
........10........20........30........40........50
| | | | |
MSIEELRNIAIVAHVDHGKTTLVDCLLKQSGTLSERTVLAERVMDSNDQE
KERGITILAKNTAITWQGNRINIVDTPGHADFGGEVERVLSMVDSVLILV
DAMDGPMPQTRFVTQKAFAMGFKPIVVVNKIDRPGARPDWVIDQVFDLFD
KLGATDEQLDFPIVYTSALNGYASLDSDVREGDMTPLYEAIMQHVSAPDV
DPDGPFQMRISQLDYNNFVGVIGIGRIQRGTLKKNMPVSVIDREGKKRQG
KVLQVLGFLGLERIEQDTAEAGDIVAISGIQELTISDTVCALDHPEALPA
LTVDEPTISMTFQVNNSPFAGNKDLSGGKFLTSRQLRDRLDREKVHNVAL
KVEEGSDADKFLVSGRGELHLSVLIENMRREGYELAVSRPEVIIKEIDGK
LMEPIEQLVVDIEEQHQGGVMEKLGTRKGQLKNMEPDGKGRVRLDYMIPA
RGLIGFQNEFRTLTQGSGLLFHVFDHYGPKEQGAIAKRQNGVMIANAPGA
TPAYALGPLEERGRLFAAEGDNVYEGQLVGIHSKDNDLTVNAIKTKPLTN
MRASGKDDAIKLTPAIKYTLEQALDFIEDDELVEVTPKEIRLRKKFLTES
DRKRAGRSG
XFF4834R

XFF4834R_chr31790 lcl|lepA-XFF4834R_chr31790

2

139

S=263 I=41 E=4.43271e-25

GTP-binding membrane protein

XFF4834R

XFF4834R_chr09750 lcl|fusA-XFF4834R_chr09750

3

175

S=258 I=37 E=1.75767e-24

protein chain elongation factor EF-G, GTP-binding

XFF4834R

XFF4834R_chr09750 lcl|fusA-XFF4834R_chr09750

243

396

S=142 I=31 E=1.97996e-10

protein chain elongation factor EF-G, GTP-binding

XFF4834R

XFF4834R_chr09750 lcl|fusA-XFF4834R_chr09750

401

477

S=109 I=30 E=2.34929e-06

protein chain elongation factor EF-G, GTP-binding

XFF4834R

XFF4834R_chr15980 lcl|prfC-XFF4834R_chr15980

7

177

S=213 I=33 E=4.8545e-19

peptide chain release factor RF-3

XFF4834R

XFF4834R_chr09760 lcl|tufB-XFF4834R_chr09760

8

213

S=193 I=31 E=1.39183e-16

protein chain elongation factor EF-Tu (duplicate of tufA)

XFF4834R

XFF4834R_chr09630 lcl|tufB-XFF4834R_chr09630

8

213

S=193 I=31 E=1.39183e-16

protein chain elongation factor EF-Tu (duplicate of tufA)

XFF4834R

XFF4834R_chr26830 lcl|XFF4834R_chr29350520_3098234_r2_XFF4834R-XFF4834R_chr26830

9

146

S=160 I=34 E=1.35138e-12

XFF4834R

XFF4834R_chr13210 lcl|cysN-XFF4834R_chr13210

43

132

S=109 I=32 E=2.09755e-06

sulfate adenylyltransferase, subunit 1

XFF4834R

YP_362763.1 lcl|typA-XCV1032

1

609

S=3133 I=98 E=0

GTP-binding elongation factor protein

XFF4834R

NP_641351.1 lcl|typA-XAC1004

1

609

S=3129 I=98 E=0

GTP-binding elongation factor protein

XFF4834R

NP_636312.2 lcl|typA-XCC0926

1

609

S=3080 I=96 E=0

GTP-binding elongation factor protein

XFF4834R

lcl|typA-XALc_0544

1

609

S=2977 I=92 E=0

probable gtp-binding elongation factor protein

XFF4834R

NP_641657.1 lcl|lepA-XAC1322

2

139

S=263 I=41 E=1.81686e-24

GTP-binding protein LepA

XFF4834R

NP_636644.1 lcl|lepA-XCC1270

2

136

S=260 I=41 E=3.81219e-24

GTP-binding protein LepA

XFF4834R

YP_363104.1 lcl|lepA-XCV1373

3

139

S=259 I=41 E=5.84403e-24

GTP-binding protein LepA

XFF4834R

YP_362726.1 lcl|fusA-XCV0995

3

175

S=259 I=37 E=5.99891e-24

elongation factor G

XFF4834R

YP_362726.1 lcl|fusA-XCV0995

243

396

S=142 I=31 E=7.37322e-10

elongation factor G

XFF4834R

YP_362726.1 lcl|fusA-XCV0995

401

477

S=109 I=30 E=9.13838e-06

elongation factor G

pubmed

1

609

S=2873 I=89 E=0

Putative translation elongation factor G ; GTP-binding Nucleotide-binding

Pubmed 12021798

 

prodomImg

pubmed

3

608

S=2172 I=68 E=0

GTP-binding protein typA/BipA ; Nucleotide-binding Phosphoprotein

Pubmed 9622352,8346018

 

prodomImg

pubmed

3

608

S=2172 I=68 E=0

GTP-binding protein typA/bipA ; Nucleotide-binding Phosphoprotein

Pubmed 9622352,18952797

 

prodomImg

pubmed

3

607

S=2161 I=67 E=0

YIHK ; GTP-binding Nucleotide-binding

Pubmed 11040434

 

prodomImg

pubmed

1

607

S=2155 I=67 E=0

Putative GTP-binding factor ; Nucleotide-binding

Pubmed 17240088

 

prodomImg

pubmed

1

608

S=2143 I=67 E=0

GTP-binding protein typA/bipA homolog ; Nucleotide-binding

Pubmed 10675023

 

prodomImg

pubmed

1

594

S=1993 I=63 E=0

Predicted TypA membrane GTPase ; GTP-binding Nucleotide-binding

Pubmed 14566056

 

prodomImg

pubmed

1

594

S=1988 I=63 E=0

Predicted TypA membrane GTPase ; GTP-binding Nucleotide-binding

Pubmed 14566056

 

prodomImg

pubmed

3

607

S=1492 I=49 E=8.88784e-172

GTP-binding protein TypA ; Nucleotide-binding

Pubmed 12957888

 

prodomImg

pubmed

4

594

S=1470 I=48 E=3.97511e-169

GTP-binding protein typA (Tyrosine phosphorylated protein A) ; Nucleotide-binding

Pubmed 9405937

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

4

200

-

Iprscan [G3DSA:2.40.30.10]

200

300

-

Iprscan IPR000640 [G3DSA:3.30.70.240]

403

492

Translation elongation factor EFG/EF2, C-terminal

Iprscan IPR000795 [PF00009]

4

197

Protein synthesis factor, GTP-binding

Iprscan IPR004161 [PF03144]

220

290

Translation elongation factor EFTu/EF1A, domain 2

Iprscan IPR000640 [PF00679]

400

488

Translation elongation factor EFG/EF2, C-terminal

Iprscan IPR000640 [SM00838]

400

488

Translation elongation factor EFG/EF2, C-terminal

Iprscan IPR005225 [TIGR00231]

4

181

Small GTP-binding protein

Iprscan IPR006298 [TIGR01394]

6

604

GTP-binding protein TypA

Iprscan IPR000795 [PS00301]

45

60

Protein synthesis factor, GTP-binding

Iprscan [seg]

219

230

-

PD407411

529

606

S=286 I=72 E=3.95373e-27

PD011418

299

372

S=237 I=65 E=4.14524e-21

PD011419

372

469

S=200 I=45 E=1.14583e-16

PDA1F714

472

528

S=168 I=54 E=9.93311e-13

PD646376

148

193

S=155 I=65 E=3.423e-11

PD249398

6

105

S=150 I=32 E=1.33383e-10

PDA2D905

195

377

S=141 I=27 E=1.46686e-09

PDA397U2

106

165

S=117 I=40 E=1.20781e-06

PD336744

71

105

S=108 I=57 E=1.78661e-05

PD681499

68

133

S=106 I=33 E=2.9367e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5eFCKaro)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

9 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa__yDD/XFF4834R_chr10100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa__yDD/XFF4834R_chr10100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa__yDD/XFF4834R_chr10100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBa__yDD/XFF4834R_chr10100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.