Xanthomonas fuscans subsp. fuscans

9 hits

  1. XFF4834R_chr05200fisXFF4834R_chr05200global DNA-binding transcriptional dual regulator (factor-for-inversion stimulation protein)
  2. XFF4834R_chr09660nusGXFF4834R_chr09660transcription antitermination protein NusG
  3. XFF4834R_chr14950argPXFF4834R_chr14950DNA-binding transcriptional activator, replication initiation inhibitor
  4. XFF4834R_chr24060cspA1XFF4834R_chr24060major cold shock protein CspA
  5. XFF4834R_chr24380sspAXFF4834R_chr24380probable stringent starvation protein A
  6. XFF4834R_chr30330cspA2XFF4834R_chr30330major cold shock protein A
  7. XFF4834R_chr30560XFF4834R_chr33200798_3512649_f1_XFF4834R-XFF4834R_chr30560XFF4834R_chr30560putative AraC family transcriptional regulator
  8. XFF4834R_chr38830XFF4834R_chr41960527_4474255_r3_XFF4834R-XFF4834R_chr38830XFF4834R_chr38830probable Type III pantothenate kinase CoaX
  9. XFF4834R_chr39300ftrAXFF4834R_chr39300Transcriptional activator FtrA

fis XFF4834R_chr05200
XFF4834R_chr05190
XFF4834R_chr05190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr05210
XFF4834R_chr05210
ID fis
AC XFF4834R_chr05200
LT XFF4834R_chr05200
OR XFF4834R_chr from 586636 to 586908 on strand -
DE global DNA-binding transcriptional dual regulator (factor-for-inversion stimulation protein)
IP DNA-binding protein Fis
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [KL] Transcription;Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120319)
MW 10132.4 Da
SQ 90 aa
 
........10........20........30........40........50
| | | | |
MNAAPSRPDTSRGAPKSPLREHVAQSVRRYLRDLDGSDADDVYEIVLREM
EIPLFVEVLNHCEGNQSRAAAMLGIHRATLRKKLKEYGLT
XFF4834R

XFF4834R_chr01970 lcl|XFF4834R_chr02090240_0235586_f3_XFF4834R-XFF4834R_chr01970

49

89

S=89 I=44 E=3.90548e-05

X.species

YP_362287.1 lcl|fis-XCV0556

1

90

S=472 I=100 E=4.03754e-51

DNA-binding protein Fis

X.species

NP_640875.1 lcl|fis-XAC0522

1

90

S=472 I=100 E=4.03754e-51

DNA-binding protein Fis

X.species

NP_635900.1 lcl|fis-XCC0508

1

90

S=469 I=99 E=1.0535e-50

DNA-binding protein Fis

X.species

lcl|fis-XALc_0309

1

89

S=424 I=91 E=2.78553e-45

probable dna-binding protein fis (factor-for-inversion stimulation protein)

X.species

YP_361963.1 lcl|XCV0232

44

89

S=96 I=48 E=1.45064e-05

sigma 54-dependent response regulator

pubmed

14

89

S=218 I=50 E=1.09833e-18

DNA-binding protein fis ; Activator Transcription regulation

Pubmed 9811652

 

prodomImg

pubmed

6

89

S=218 I=46 E=1.20888e-18

Fis ; Activator DNA-binding Transcription regulation

Pubmed 15294770

 

prodomImg

pubmed

6

89

S=218 I=46 E=1.20888e-18

Fis ; Activator DNA-binding Transcription regulation

Pubmed 15294770

 

prodomImg

pubmed

6

89

S=218 I=46 E=1.20888e-18

Fis ; Activator DNA-binding Transcription regulation

Pubmed 15294770

 

prodomImg

pubmed

6

89

S=217 I=46 E=1.25178e-18

Fis ; Activator DNA-binding Transcription regulation

Pubmed 15294770

 

prodomImg

pubmed

6

89

S=217 I=46 E=1.25178e-18

Fis ; Activator DNA-binding Transcription regulation

Pubmed 15294770

 

prodomImg

pubmed

6

89

S=217 I=46 E=1.25178e-18

DNA-binding protein fis ; Activator Transcription regulation

Pubmed 9811652

 

prodomImg

pubmed

6

89

S=217 I=46 E=1.25178e-18

DNA-binding protein fis ; Activator Transcription regulation

Pubmed 7536730

 

prodomImg

pubmed

6

89

S=217 I=46 E=1.25178e-18

DNA-binding protein fis ; Activator Transcription regulation

Pubmed 2835774,2837762

 

prodomImg

pubmed

6

89

S=216 I=46 E=1.77414e-18

DNA-binding protein fis ; Activator Transcription regulation

Pubmed 9811652

 

prodomImg

sp

1

90

S=472 I=100 E=1.05004e-49

Putative fis-like DNA-binding protein

 

prodomImg

sp

1

90

S=469 I=99 E=2.73983e-49

Putative fis-like DNA-binding protein

 

prodomImg

sp

1

90

S=412 I=84 E=2.20957e-42

Putative fis-like DNA-binding protein

 

prodomImg

sp

1

90

S=403 I=82 E=2.76946e-41

Putative fis-like DNA-binding protein

 

prodomImg

sp

18

89

S=226 I=56 E=7.6802e-20

DNA-binding protein fis ; Activator Transcription regulation

 

prodomImg

Iprscan [G3DSA:1.10.1680.10]

5

90

-

Iprscan IPR005412 [PIRSF002097]

1

90

DNA-binding protein Fis

Iprscan IPR002197 [PF02954]

47

87

Helix-turn-helix, Fis-type

PD362379

1

46

S=223 I=93 E=1.54032e-19

PD947233

23

83

S=135 I=43 E=7.4667e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OUojjzab)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

24 hits
swiss-prot

Swiss-Prot ncbi-blastp

121 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr05200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr05200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr05200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr05200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
nusG XFF4834R_chr09660
XFF4834R_chr09650
XFF4834R_chr09650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09670
XFF4834R_chr09670
ID nusG
AC XFF4834R_chr09660
LT XFF4834R_chr09660
OR XFF4834R_chr from 1102916 to 1103473 on strand +
DE transcription antitermination protein NusG
IP Transcription antitermination protein, NusG; Ribosomal protein L26e, archaeal
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
Biological Process: positive regulation of RNA elongation from RNA polymerase II promoter (GO:0032968)
DNA-dependent (GO:0006355)
Molecular Function: transcription elongation regulator activity (GO:0003711)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120314)
MW 21190 Da
SQ 185 aa
 
........10........20........30........40........50
| | | | |
MKRWYVVHAYSGFEKSVAQALRDRIARAEMEDRFGDVLVPTEEVIEMRAG
QKRRSERKFFPGYVLVQIETHEEAGIPRIDNESWHLVKETSKVMGFIGGT
ADRPLPIRDEEADAILQRVQDGVEKPRPKVLFEPGQMVRVTEGPFNDFNG
VVEEVNYEKSRLRVAVLIFGRSTPVELEFGQVEKG
Show or not Domain decomposition
 
X.species

NP_641307.1 lcl|nusG-XAC0960

1

185

S=955 I=99 E=5.53506e-109

transcription antitermination protein NusG

X.species

YP_362717.1 lcl|nusG-XCV0986

1

185

S=953 I=99 E=9.84083e-109

transcription antitermination protein NusG

X.species

NP_636269.1 lcl|nusG-XCC0883

1

185

S=936 I=97 E=1.0352e-106

transcription antitermination protein NusG

X.species

lcl|nusG-XALc_0502

1

185

S=911 I=94 E=1.17689e-103

probable transcription antitermination protein nusg

Iprscan IPR001062 [PR00338]

56

68

Transcription antitermination protein, NusG

Iprscan IPR001062 [PR00338]

143

158

Transcription antitermination protein, NusG

Iprscan IPR001062 [PR00338]

161

177

Transcription antitermination protein, NusG

Iprscan IPR006645 [G3DSA:3.30.70.940]

1

123

Transcription antitermination protein, NusG, N-terminal

Iprscan IPR014722 [G3DSA:2.30.30.30]

123

185

Translation protein SH3-like, subgroup

Iprscan IPR006645 [PF02357]

2

110

Transcription antitermination protein, NusG, N-terminal

Iprscan IPR005824 [PF00467]

134

164

KOW

Iprscan IPR006645 [SM00738]

1

119

Transcription antitermination protein, NusG, N-terminal

Iprscan IPR005824 [SM00739]

131

158

KOW

Iprscan IPR001062 [TIGR00922]

4

185

Transcription antitermination protein, NusG

Iprscan IPR015869 [PS01014]

168

177

Transcription antitermination protein, NusG, bacteria, conserved site

Iprscan IPR006645 [SSF82679]

1

122

Transcription antitermination protein, NusG, N-terminal

Iprscan IPR008991 [SSF50104]

128

185

Translation protein SH3-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8yIvDfRK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

64 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr09660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr09660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr09660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr09660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
argP XFF4834R_chr14950
XFF4834R_chr14940
XFF4834R_chr14940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14960
XFF4834R_chr14960
ID argP
AC XFF4834R_chr14950
LT XFF4834R_chr14950
OR XFF4834R_chr from 1714621 to 1715523 on strand -
DE DNA-binding transcriptional activator, replication initiation inhibitor
IP Bacterial regulatory protein, LysR; LysR, substrate-binding
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: validated by darrasse (20120314)
MW 32673.4 Da
SQ 300 aa
 
........10........20........30........40........50
| | | | |
MDLLHPQLAAFAAVLEEGSFDAAAQRLALTPSAISQRIKALEDRLGQVLV
MRTAPCRPTPAGERLLRRLKPMQVLEAEAVADFLPADGIAGHPRTLAIAV
NDDSLQTWFLQALSSLHRAHGFLFDVQMDDQDHTLELLRAGSVLGAVTSE
RASLQGCNVQALGVMRYHAIASAAFVAAHFQGGFTAHALGKAPMLVFNRK
DTLQARFVRRITRTRLTPPTHYLPTSTGFVEAAARGLGWCLAPEAMVLPA
VRNKQVVIIDPTRWLDVPLYWQYAAVRSNALQQLSQALCKAAATSLRGSR
XFF4834R

XFF4834R_chr06800 lcl|XFF4834R_chr07150040_0780948_f1_XFF4834R-XFF4834R_chr06800

1

120

S=103 I=34 E=4.60048e-06

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr41800 lcl|XFF4834R_chr_4862828_4863730_r3_XFF4834R-XFF4834R_chr41800

7

71

S=101 I=47 E=9.08135e-06

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr29860 lcl|XFF4834R_chr32430654_3431766_f1_XFF4834R-XFF4834R_chr29860

7

120

S=101 I=32 E=9.82266e-06

XFF4834R

XFF4834R_chr37280 lcl|XFF4834R_chr40410318_4311265_r3_XFF4834R-XFF4834R_chr37280

8

83

S=99 I=39 E=1.58667e-05

XFF4834R

XFF4834R_chr05050 lcl|XFF4834R_chr05180587_0570588_r1_XFF4834R-XFF4834R_chr05050

7

66

S=96 I=44 E=3.2151e-05

XFF4834R

XFF4834R_chr11880 lcl|XFF4834R_chr12460277_1335161_r2_XFF4834R-XFF4834R_chr11880

1

76

S=95 I=41 E=4.4391e-05

XFF4834R

XFF4834R_chr30170 lcl|XFF4834R_chr32750197_3468231_f1_XFF4834R-XFF4834R_chr30170

11

53

S=94 I=47 E=6.07587e-05

XFF4834R

XFF4834R_chr27640 lcl|XFF4834R_chr30210469_3191413_r3_XFF4834R-XFF4834R_chr27640

13

67

S=93 I=46 E=8.76278e-05

predicted DNA-binding transcriptional regulator

X.species

YP_364995.1 lcl|iciA-XCV3264

1

300

S=1369 I=88 E=8.33844e-159

chromosome replication initiation inhibitor protein

X.species

NP_643443.1 lcl|XAC3134-XAC3134

1

300

S=1360 I=89 E=9.25039e-158

chromosome replication initiation inhibitor protein

X.species

NP_638303.1 lcl|XCC2955

1

297

S=1109 I=72 E=2.23396e-127

chromosome replication initiation inhibitor protein

X.species

NP_640658.1 lcl|XAC0302-XAC0302

7

71

S=116 I=44 E=5.04822e-07

LysR family transcriptional regulator

X.species

NP_635680.1 lcl|XCC0285

7

71

S=115 I=44 E=6.55743e-07

LysR family transcriptional regulator

X.species

YP_364731.1 lcl|XCV3000

7

83

S=112 I=41 E=1.46249e-06

LysR family transcriptional regulator

X.species

NP_636853.1 lcl|oxyR-XCC1481

7

120

S=109 I=32 E=3.12261e-06

hydrogen peroxide-inducible genes activator protein

X.species

YP_362463.1 lcl|XCV0732

1

120

S=108 I=34 E=4.87113e-06

LysR family transcriptional regulator

X.species

NP_641024.1 lcl|XAC0671-XAC0671

1

120

S=108 I=34 E=5.08817e-06

transcriptional regulator

X.species

YP_363303.1 lcl|XCV1572

7

120

S=105 I=33 E=1.22744e-05

LysR family transcriptional regulator

pubmed

7

272

S=494 I=41 E=3.27761e-51

Transcriptional regulator ; DNA-binding regulation

Pubmed 16707707

 

prodomImg

pubmed

4

297

S=441 I=37 E=7.21029e-45

Lysine export transcriptional regulatory protein lysG ; DNA-binding regulation

Pubmed 8971704

 

prodomImg

pubmed

8

297

S=418 I=35 E=4.49152e-42

Chromosome initiation inhibitor ; DNA-binding Transcription regulation

Pubmed 9286976

 

prodomImg

pubmed

8

297

S=382 I=33 E=1.2095e-37

Chromosome initiation inhibitor ; DNA-binding Transcription regulation

Pubmed 2034653

 

prodomImg

pubmed

8

297

S=370 I=34 E=3.41064e-36

Chromosome initiation inhibitor ; DNA-binding Transcription regulation

Pubmed 12542086

 

prodomImg

pubmed

14

288

S=284 I=28 E=8.44874e-26

Putative uncharacterized protein ; DNA-binding Transcription regulation

Pubmed 11401961

 

prodomImg

pubmed

7

151

S=133 I=35 E=1.80827e-07

Nitrogen assimilation transcriptional activator NtcB protein ; DNA-binding regulation

Pubmed 8990301,11069684

 

prodomImg

pubmed

7

94

S=127 I=44 E=8.24356e-07

Probable HTH-type transcriptional regulator lrrA ; DNA-binding regulation

Pubmed 8661945

 

prodomImg

pubmed

7

70

S=124 I=48 E=1.80676e-06

Probable nitrogen assimilation transcriptional activator ; DNA-binding regulation

Pubmed 7814317

 

prodomImg

pubmed

8

66

S=117 I=47 E=1.4266e-05

Putative transcriptional regulator ; DNA-binding regulation

Pubmed 12055289

 

prodomImg

Iprscan IPR011991 [G3DSA:1.10.10.10]

3

88

Winged helix repressor DNA-binding

Iprscan IPR000847 [PF00126]

7

63

HTH transcriptional regulator, LysR

Iprscan IPR005119 [PF03466]

89

297

LysR, substrate-binding

Iprscan IPR017685 [TIGR03298]

3

296

Transcriptional regulator, ArgP

Iprscan IPR000847 [PS50931]

1

59

HTH transcriptional regulator, LysR

Iprscan [seg]

169

178

-

Iprscan [seg]

209

220

-

PD013561

93

208

S=276 I=50 E=4.98618e-26

PDA1X6I1

55

95

S=205 I=93 E=2.16165e-17

PDA1G3B9

221

292

S=181 I=43 E=1.71889e-14

PD862041

8

46

S=110 I=56 E=7.25951e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KGb1Q1Ke)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

90 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

9 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr14950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr14950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr14950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr14950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cspA1 XFF4834R_chr24060
XFF4834R_chr24050
XFF4834R_chr24050
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24070
XFF4834R_chr24070
ID cspA1
AC XFF4834R_chr24060
LT XFF4834R_chr24060
OR XFF4834R_chr from 2773841 to 2774056 on strand -
DE major cold shock protein CspA
IP Cold shock, CspA; Nucleic acid-binding, OB-fold-like
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN according to GenProtEC :- regulation -transcriptional -activator -- -cell process -adaptation to stress -temperature extremes-
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 7649.6 Da
SQ 71 aa
 
........10........20........30........40........50
| | | | |
MSDASRQSGVVKWFNDAKGFGFITPESGPDLFVHFRAIQGTGFKSLQEGQ
KVTFVAVQGQKGMQADQVQAG
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr30330 lcl|XFF4834R_chr32940711_3484926_r1_XFF4834R-XFF4834R_chr30330

1

70

S=270 I=73 E=3.12646e-27

XFF4834R

XFF4834R_chr31640 lcl|cspD-XFF4834R_chr31640

8

68

S=200 I=61 E=7.8942e-19

cold shock protein homolog

XFF4834R

XFF4834R_chr23370 lcl|XFF4834R_chr25540883_2704497_f1_XFF4834R-XFF4834R_chr23370

6

69

S=85 I=37 E=8.36609e-05

X.species

YP_364323.1 lcl|cspA-XCV2592

4

70

S=328 I=96 E=9.77753e-34

major cold shock protein

X.species

NP_642711.1 lcl|cspA-XAC2395

4

70

S=328 I=96 E=9.77753e-34

major cold shock protein

X.species

NP_637642.1 lcl|cspA-XCC2287

1

70

S=327 I=94 E=1.46019e-33

major cold shock protein

X.species

lcl|cspA2-XALc_1104

6

69

S=284 I=87 E=2.32845e-28

probable cold-shock protein

X.species

YP_363253.1 lcl|cspA-XCV1522

1

70

S=270 I=73 E=1.23006e-26

major cold shock protein

X.species

NP_636795.1 lcl|cspA-XCC1422

1

70

S=270 I=73 E=1.23006e-26

major cold shock protein

X.species

NP_641799.1 lcl|cspA-XAC1465

1

70

S=270 I=73 E=1.23006e-26

major cold shock protein

X.species

lcl|cspA1-XALc_1131

1

69

S=254 I=70 E=1.10602e-24

probable cold shock protein

X.species

YP_363120.1 lcl|scoF-XCV1389

8

68

S=200 I=61 E=3.10585e-18

cold shock protein

X.species

NP_636660.1 lcl|scoF-XCC1286

8

68

S=200 I=61 E=3.10585e-18

cold shock protein

X.species

NP_641672.1 lcl|scoF-XAC1337

8

68

S=200 I=61 E=3.10585e-18

cold shock protein

Iprscan IPR002059 [PR00050]

9

24

Cold-shock protein, DNA-binding

Iprscan IPR002059 [PR00050]

29

38

Cold-shock protein, DNA-binding

Iprscan IPR002059 [PR00050]

44

62

Cold-shock protein, DNA-binding

Iprscan IPR012340 [G3DSA:2.40.50.140]

6

71

Nucleic acid-binding, OB-fold

Iprscan IPR012156 [PIRSF002599]

6

71

Cold shock, CspA

Iprscan [PTHR11544]

6

68

-

Iprscan IPR002059 [PF00313]

7

69

Cold-shock protein, DNA-binding

Iprscan IPR011129 [SM00357]

8

71

Cold shock protein

Iprscan IPR019844 [PS00352]

20

38

Cold-shock conserved site

Iprscan IPR016027 [SSF50249]

7

70

Nucleic acid-binding, OB-fold-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jkJlfCz1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

193 hits
swiss-prot

Swiss-Prot ncbi-blastp

153 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24060.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24060.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
sspA XFF4834R_chr24380
XFF4834R_chr24370
XFF4834R_chr24370
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2589
XFF4834R_chr_2589
ID sspA
AC XFF4834R_chr24380
LT XFF4834R_chr24380
OR XFF4834R_chr from 2812869 to 2813504 on strand -
DE probable stringent starvation protein A
IP Intracellular chloride channel; Glutathione S-transferase, N-terminal; Glutathione S-transferase, C-terminal-like; Glutathione S-transferase, predicted
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro


Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100521)
MW 23883.4 Da
SQ 211 aa
 
........10........20........30........40........50
| | | | |
MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPEDL
IDLNPYHSVPTLVERDLVLYAASVVSEYLDERYPHPPLMPVDPLSRARLR
LAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASVPLFKASKFFL
NPEMSLADCAMAPIIWRLDALEISLPKDGKAIEDYGNRIFRNPGFIRSLT
DQEKKLRDLPG
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one j4EVUDpo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

97 hits
swiss-prot

Swiss-Prot ncbi-blastp

35 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24380.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24380.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr24380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cspA2 XFF4834R_chr30330
XFF4834R_chr30320
XFF4834R_chr30320
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30340
XFF4834R_chr30340
ID cspA2
AC XFF4834R_chr30330
LT XFF4834R_chr30330
OR XFF4834R_chr from 3484711 to 3484926 on strand -
DE major cold shock protein A
IP Cold shock protein; Cold shock, CspA; Nucleic acid-binding, OB-fold-like
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN according to GenProtEC :- regulation -transcriptional -activator -- -cell process -adaptation to stress -temperature extremes-
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 7945 Da
SQ 71 aa
 
........10........20........30........40........50
| | | | |
MSNIERENGVVKWFNDAKGFGFISRENGEDVFVHFRAIQIQGFKSLKEGQ
KVSFTVVQGQKGLQADAVQVV
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr24060 lcl|XFF4834R_chr26250841_2774056_r3_XFF4834R-XFF4834R_chr24060

1

70

S=270 I=73 E=3.12646e-27

XFF4834R

XFF4834R_chr31640 lcl|cspD-XFF4834R_chr31640

7

71

S=216 I=64 E=9.4962e-21

cold shock protein homolog

X.species

YP_363253.1 lcl|cspA-XCV1522

1

71

S=354 I=100 E=7.54609e-37

major cold shock protein

X.species

NP_636795.1 lcl|cspA-XCC1422

1

71

S=354 I=100 E=7.54609e-37

major cold shock protein

X.species

NP_641799.1 lcl|cspA-XAC1465

1

71

S=354 I=100 E=7.54609e-37

major cold shock protein

X.species

lcl|cspA1-XALc_1131

3

71

S=300 I=88 E=2.35276e-30

probable cold shock protein

X.species

NP_637642.1 lcl|cspA-XCC2287

5

71

S=270 I=78 E=1.24083e-26

major cold shock protein

X.species

YP_364323.1 lcl|cspA-XCV2592

5

71

S=264 I=75 E=6.56047e-26

major cold shock protein

X.species

NP_642711.1 lcl|cspA-XAC2395

5

71

S=264 I=75 E=6.56047e-26

major cold shock protein

X.species

lcl|cspA2-XALc_1104

5

71

S=242 I=73 E=2.59703e-23

probable cold-shock protein

X.species

YP_363120.1 lcl|scoF-XCV1389

7

71

S=216 I=64 E=3.73614e-20

cold shock protein

X.species

NP_636660.1 lcl|scoF-XCC1286

7

71

S=216 I=64 E=3.73614e-20

cold shock protein

X.species

NP_641672.1 lcl|scoF-XAC1337

7

71

S=216 I=64 E=3.73614e-20

cold shock protein

Iprscan IPR002059 [PR00050]

9

24

Cold-shock protein, DNA-binding

Iprscan IPR002059 [PR00050]

29

38

Cold-shock protein, DNA-binding

Iprscan IPR002059 [PR00050]

44

62

Cold-shock protein, DNA-binding

Iprscan IPR012340 [G3DSA:2.40.50.140]

6

71

Nucleic acid-binding, OB-fold

Iprscan IPR012156 [PIRSF002599]

6

71

Cold shock, CspA

Iprscan [PTHR11544]

1

68

-

Iprscan IPR002059 [PF00313]

6

70

Cold-shock protein, DNA-binding

Iprscan IPR011129 [SM00357]

8

71

Cold shock protein

Iprscan IPR019844 [PS00352]

20

38

Cold-shock conserved site

Iprscan IPR016027 [SSF50249]

6

71

Nucleic acid-binding, OB-fold-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one isX5fjgv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

197 hits
swiss-prot

Swiss-Prot ncbi-blastp

153 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30330.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30330.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr33200798_3512649_f1_XFF4834R-XFF4834R_chr30560 XFF4834R_chr30560
XFF4834R_chr30550
XFF4834R_chr30550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30570
XFF4834R_chr30570
ID XFF4834R_chr33200798_3512649_f1_XFF4834R-XFF4834R_chr30560
AC XFF4834R_chr30560
LT XFF4834R_chr30560
OR XFF4834R_chr from 3511798 to 3512649 on strand +
DE putative AraC family transcriptional regulator
IP 4-hydroxyphenylacetate catabolism regulatory protein hpaA; Helix-turn-helix, AraC domain
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: sequence-specific DNA binding (GO:0043565)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120309)
MW 30768.8 Da
SQ 283 aa
 
........10........20........30........40........50
| | | | |
MSIENPPTQIDALPPGVRASFEKADGPVLIAFLAELREVWAPETAWHAHV
RGQLMYVEHGVLTVHTEQGALSLPPGCAGWMPPGQQHTVELAGPMRGWGV
VVRPDACAALPAQGGVIRLTGLAREAIMRAASWPLDQPLDATRQRLAAVL
LDELCQVQIDHLHLPMPADRRLLRIARQLLDTPADPRPLDAWANWGGLSP
RSLSRHFRDETGLSFAQWRQQARLTEGLRRLSQGHAVAQVSDQLGYSSPS
AFVSVFHRHFGAPPTRYLAGSHARGLASPAASG
XFF4834R

XFF4834R_chr39300 lcl|XFF4834R_chr42520214_4528224_f1_XFF4834R-XFF4834R_chr39300

189

267

S=101 I=30 E=7.25407e-06

XFF4834R

XFF4834R_chr25740 lcl|XFF4834R_chr28300192_2984908_f2_XFF4834R-XFF4834R_chr25740

168

269

S=95 I=26 E=3.90281e-05

XFF4834R

XFF4834R_chr03390 lcl|XFF4834R_chr03510360_0390247_r3_XFF4834R-XFF4834R_chr03390

171

271

S=94 I=31 E=6.24955e-05

X.species

YP_363229.1 lcl|XCV1498

1

283

S=1410 I=96 E=8.44278e-164

AraC family transcriptional regulator

X.species

NP_641777.1 lcl|XAC1442-XAC1442

13

283

S=1372 I=98 E=2.82722e-159

transcriptional regulator

X.species

NP_636770.1 lcl|XCC1396

1

283

S=1261 I=86 E=8.1021e-146

transcriptional regulator

X.species

NP_642552.1 lcl|yeaM-XAC2235

47

270

S=335 I=36 E=1.21285e-33

AraC family transcriptional regulator

X.species

YP_364077.1 lcl|XCV2346

168

269

S=122 I=31 E=8.22898e-08

AraC family transcriptional regulator

X.species

NP_635706.1 lcl|XCC0311

183

267

S=112 I=35 E=1.33976e-06

transcriptional regulator

X.species

YP_364180.1 lcl|XCV2449

168

264

S=112 I=31 E=1.44913e-06

AraC family transcriptional regulator

X.species

NP_637718.1 lcl|adpA-XCC2364

158

264

S=106 I=31 E=8.43296e-06

AraC family transcriptional regulator

X.species

NP_644363.1 lcl|ftrA-XAC4064

189

267

S=101 I=30 E=3.20122e-05

transcriptional activator FtrA

pubmed

44

258

S=374 I=39 E=1.05285e-36

Transcriptional factor PhcT ; DNA-binding regulation

Pubmed 12081966

 

prodomImg

pubmed

47

268

S=365 I=36 E=1.23072e-35

AraC protein ; DNA-binding Transcription regulation

Pubmed 12904565

 

prodomImg

pubmed

47

267

S=289 I=32 E=1.9055e-26

Putative transcriptional regulator ; DNA-binding regulation

Pubmed 9791097,12823813

 

prodomImg

pubmed

165

277

S=183 I=33 E=1.27321e-13

HTH-type transcriptional repressor of iron proteins A ; DNA-binding regulation

Pubmed 16179344

 

prodomImg

pubmed

166

264

S=165 I=39 E=1.91488e-11

AraC-type transcriptional regulator ; DNA-binding regulation

Pubmed 16291687

 

prodomImg

pubmed

184

266

S=126 I=36 E=1.20128e-06

HTH AraC-type regulator ; DNA-binding Transcription regulation

Pubmed 17564599

 

prodomImg

pubmed

168

269

S=122 I=31 E=3.00072e-06

AraC family transcriptional regulator Putative transcriptional regulator, AraC family ; DNA-binding regulation

Pubmed 18487337,18502858

 

prodomImg

pubmed

146

274

S=116 I=28 E=1.61444e-05

Arabinose operon regulatory protein ; Activator catabolism Carbohydrate metabolism Cytoplasm DNA-binding Repressor Transcription regulation

Pubmed 7019009,7008027

 

prodomImg

pubmed

170

267

S=114 I=30 E=2.89546e-05

AgpT ; DNA-binding Plasmid Transcription regulation

Pubmed 10867229

 

prodomImg

pubmed

146

270

S=113 I=29 E=3.96306e-05

Arabinose operon regulatory protein ; Activator catabolism Carbohydrate metabolism Cytoplasm DNA-binding Repressor Transcription regulation

Pubmed 2965663

 

prodomImg

sp

47

269

S=302 I=33 E=3.77464e-28

Uncharacterized HTH-type transcriptional regulator yeaM ; DNA-binding regulation

 

prodomImg

Iprscan IPR003313 [PF02311]

29

98

AraC protein, arabinose-binding/dimerisation

Iprscan IPR000005 [PF00165]

175

220

Helix-turn-helix, AraC type

Iprscan IPR000005 [PF00165]

231

269

Helix-turn-helix, AraC type

Iprscan IPR018060 [SM00342]

186

268

Helix-turn-helix, AraC domain

Iprscan IPR018060 [PS01124]

170

270

Helix-turn-helix, AraC domain

PD275086

71

162

S=180 I=42 E=2.21151e-14

PD714020

13

42

S=150 I=100 E=1.20773e-10

PDA86865

43

73

S=149 I=90 E=1.27259e-10

PD376793

162

218

S=136 I=53 E=5.13059e-09

PD884796

217

268

S=135 I=46 E=7.33523e-09

PDA6N2H6

215

264

S=109 I=42 E=8.71076e-06

PDA2N018

223

269

S=108 I=44 E=1.28958e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xrdP4PNV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr30560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr41960527_4474255_r3_XFF4834R-XFF4834R_chr38830 XFF4834R_chr38830
XFF4834R_chr38820
XFF4834R_chr38820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38840
XFF4834R_chr38840
ID XFF4834R_chr41960527_4474255_r3_XFF4834R-XFF4834R_chr38830
AC XFF4834R_chr38830
LT XFF4834R_chr38830
OR XFF4834R_chr from 4473527 to 4474255 on strand -
DE probable Type III pantothenate kinase CoaX
IP Bordetella pertussis Bvg accessory factor
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
Biological Process: positive regulation of transcription (GO:0045941)
Molecular Function: transcription activator activity (GO:0016563)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 25014.3 Da
SQ 242 aa
 
........10........20........30........40........50
| | | | |
MSEWLFDLGNSRFKYAPLHGNRAGQVQAWAHGAEAMDAAALAALPSGRIA
YVASVAAPALTQRMIACLQERFAQVRIVRTTAECAGIRIAYADPSRFGVD
RFLALLGARGDAPVLVAGVGTALTIDVLGADGLHHGGRIAASPTTMREAL
HARAVQLPASGGDYVELAIDTDDALTSGCDGAAVALIERSLQHAQRSLGV
PVRLLVHGGGAPPLLPLLPDATFRAALVLDGLATWATAASSP
Hamap COAX_MF_01274 raw_score=1476 norm_score=14.362

Type III pantothenate kinase [coaX].

X.species

NP_644316.1 lcl|baf-XAC4017

1

242

S=1079 I=90 E=8.36749e-124

pantothenate kinase

X.species

YP_365840.1 lcl|XCV4109

1

242

S=1062 I=88 E=9.27488e-122

pantothenate kinase

X.species

NP_639276.1 lcl|baf-XCC3937

1

242

S=870 I=76 E=1.58966e-98

pantothenate kinase

X.species

lcl|XALc_0252

1

238

S=664 I=61 E=1.5842e-73

putative transcriptional regulator, bvg accessory factor family transcription regulator protein

pubmed

5

211

S=160 I=29 E=5.65065e-11

Putative uncharacterized protein ; ATP-binding Coenzyme biosynthesis Cytoplasm Kinase Nucleotide-binding Transferase

Pubmed 16309397

 

prodomImg

pubmed

54

210

S=148 I=33 E=1.66442e-09

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10417135

 

prodomImg

pubmed

48

233

S=146 I=29 E=2.85776e-09

Type III pantothenate kinase EC=2.7.1.33 ; Antibiotic resistance ATP-binding Coenzyme biosynthesis Cytoplasm Metal-binding Nucleotide-binding

Pubmed 16905099

 

prodomImg

pubmed

54

210

S=145 I=33 E=3.77741e-09

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transcription regulation Transferase

Pubmed 7601846

 

prodomImg

pubmed

68

233

S=144 I=34 E=5.89259e-09

Putative uncharacterized protein ; ATP-binding Coenzyme biosynthesis Cytoplasm Kinase Nucleotide-binding Transferase

Pubmed 16309397

 

prodomImg

pubmed

68

209

S=132 I=32 E=1.48359e-07

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Metal-binding Nucleotide-binding Transferase

Pubmed 18700039

 

prodomImg

pubmed

87

179

S=123 I=33 E=2.17549e-06

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Metal-binding Nucleotide-binding Transferase

Pubmed 19008447

 

prodomImg

sp

1

242

S=1079 I=90 E=2.11152e-122

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

242

S=1062 I=88 E=2.34049e-120

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

242

S=1012 I=87 E=2.39051e-114

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

242

S=1012 I=87 E=2.39051e-114

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

sp

1

242

S=1012 I=87 E=2.39051e-114

Type III pantothenate kinase EC=2.7.1.33 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

 

prodomImg

Iprscan [MF_01274]

2

240

-

Iprscan IPR004619 [PF03309]

3

193

Bordetella pertussis Bvg accessory factor

Iprscan IPR004619 [TIGR00671]

3

237

Bordetella pertussis Bvg accessory factor

Iprscan [seg]

28

43

-

Iprscan [seg]

212

219

-

PDA4N1O5

50

85

S=175 I=97 E=9.37023e-14

PD690409

1

49

S=170 I=65 E=4.08949e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one h1nF6SUY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

123 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr38830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr38830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr38830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7tCdmf/XFF4834R_chr38830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ftrA XFF4834R_chr39300
XFF4834R_chr39290
XFF4834R_chr39290
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39310
XFF4834R_chr39310
ID ftrA
AC XFF4834R_chr39300
LT XFF4834R_chr39300
OR XFF4834R_chr from 4527214 to 4528224 on strand +
DE Transcriptional activator FtrA
IP ThiJ/PfpI; Helix-turn-helix, AraC domain
CL 3.1.2.2 Activator GO:0016563
EC
GO InterPro
Biological Process: regulation of transcription (GO:0045449)
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: sequence-specific DNA binding (GO:0043565)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN 58% id with FtrA (Caulobacter crescentus)
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 36469.5 Da
SQ 336 aa
 
........10........20........30........40........50
| | | | |
MPTSTPRARRHGLPPLVVVVAYDQLGLFEFGITTEIFGLPRPEVGPGWYR
FAIAAAEPGPLRALGGLRLEVDGGLDLLDAAHTIIVPSWRDTSASAPAAL
IKALQRAHKRKTRIVSICAGAFVLAQAGLLQGRRATTHWRNAEVLASHYP
QITVEPGVLYVDEGDILTSAGSAAGIDLCLHIVRADFGPAVANQVAKRLV
MPVHRDGGQAQFIDRPVPPIHESARLGPLLERITQDLTANHCVDALASAA
GMSRRTFLRRFQATTGMSPGKWIVNERLNRAREMLETSGADIEQIATRCG
FGSTETLRHHFRRTLALSPTQYRRVFGGHRDAGEGI
XFF4834R

XFF4834R_chr22820 lcl|XFF4834R_chr24870286_2640708_r1_XFF4834R-XFF4834R_chr22820

243

322

S=114 I=40 E=2.40903e-07

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr25740 lcl|XFF4834R_chr28300192_2984908_f2_XFF4834R-XFF4834R_chr25740

225

327

S=112 I=27 E=4.35837e-07

XFF4834R

XFF4834R_chr17900 lcl|XFF4834R_chr19080421_2048329_r3_XFF4834R-XFF4834R_chr17900

243

335

S=102 I=27 E=8.74746e-06

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr30560 lcl|XFF4834R_chr33200798_3512649_f1_XFF4834R-XFF4834R_chr30560

243

322

S=101 I=30 E=9.96965e-06

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr05920 lcl|XFF4834R_chr06130827_0667771_f2_XFF4834R-XFF4834R_chr05920

226

324

S=98 I=31 E=2.51217e-05

X.species

NP_644363.1 lcl|ftrA-XAC4064

1

336

S=1639 I=94 E=0

transcriptional activator FtrA

X.species

NP_637718.1 lcl|adpA-XCC2364

14

326

S=563 I=40 E=4.03801e-61

AraC family transcriptional regulator

X.species

NP_638911.2 lcl|XCC3565

71

196

S=166 I=34 E=4.57828e-13

ThiJ/PfpI family protein

X.species

NP_635706.1 lcl|XCC0311

243

325

S=145 I=35 E=1.79663e-10

transcriptional regulator

X.species

YP_364077.1 lcl|XCV2346

243

322

S=121 I=33 E=1.53184e-07

AraC family transcriptional regulator

X.species

NP_642483.2 lcl|XAC2166-XAC2166

243

322

S=115 I=40 E=8.53404e-07

transcriptional regulator

X.species

YP_364180.1 lcl|XCV2449

243

324

S=113 I=30 E=1.40277e-06

AraC family transcriptional regulator

X.species

NP_637770.1 lcl|XCC2416

225

327

S=113 I=27 E=1.49105e-06

transcriptional regulator

X.species

YP_362360.1 lcl|XCV0629

98

212

S=112 I=35 E=1.62688e-06

putative secreted protein

X.species

YP_364480.1 lcl|XCV2749

225

327

S=112 I=27 E=1.64113e-06

AraC family transcriptional regulator

pubmed

16

319

S=632 I=43 E=6.77196e-68

AdpA ; DNA-binding Transcription regulation

Pubmed 10540289

 

prodomImg

pubmed

17

328

S=620 I=44 E=1.84417e-66

Putative AraC-family transcriptional regulator ; DNA-binding regulation

Pubmed 11832503,15522084

 

prodomImg

pubmed

13

326

S=560 I=40 E=3.78043e-59

Putative AraC-family transcription regulator Transcriptional regulator ; DNA-binding regulation

Pubmed