Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr13550XFF4834R_chr14460672_1558134_f1_XFF4834R-XFF4834R_chr13550XFF4834R_chr13550putative site specific DNA methyltransferase (adenine specific)
  2. XFF4834R_chr31640cspDXFF4834R_chr31640cold shock protein CspD

XFF4834R_chr14460672_1558134_f1_XFF4834R-XFF4834R_chr13550 XFF4834R_chr13550
XFF4834R_chr13540
XFF4834R_chr13540
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13560
XFF4834R_chr13560
ID XFF4834R_chr14460672_1558134_f1_XFF4834R-XFF4834R_chr13550
AC XFF4834R_chr13550
LT XFF4834R_chr13550
OR XFF4834R_chr from 1555672 to 1558134 on strand +
DE putative site specific DNA methyltransferase (adenine specific)
IP DNA methylase, adenine-specific
CL 3.1.1.2 Methylation GO:0006306
EC
GO InterPro
Biological Process: DNA methylation (GO:0006306)
Molecular Function: N-methyltransferase activity (GO:0008170)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN blastX : 61% identity on 809 aa putative DNA methylase of Xcv ; blastx/NCBI : 95% identity 95% coverage with site specific DNA methyltransferase (adenine specific) of Xcc, comparative genomic and no study of fonction in article Vorholter 2008 but prediction by annotation and with interPro
CC COG: [V] Defense mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20100623)
MW 92709.2 Da
SQ 820 aa
 
........10........20........30........40........50
| | | | |
MISGEVLACEFAKFSDHFGFFLPLAGISTIKEIKENPFDVRATGRLTKLY
IELLQNNKTWASDERRADMNHFMARLVFCFFAEDTDIFQGASLFTQTLQT
MTEPDGSNTHTVLETIFRAMNLATEERATAKLPGWAERFPYVNGGLFSGS
TDVPVFTRTARSYLIRTGELKWQEINPDIFGSMIQAVADEEERGSLGMHY
TSVPNILKVLNPLFLDDLRAQLEAAGENKVKLLNLRKRMARIRVFDPACG
SGNFLVIAYKQMREIEAEINRRRGETELRTEIPLTNFRGIELREFPAEIA
RLALIIAEFQCDQLYRGQKEALADVLPLDSQNWITCDNALRLDWLAICPP
TGITVKLIGDDLFDASIDQAEIDFENEGGETYICGNPPYVGRKYQTDAQK
AELKAVFRGRSNDTLSLDYVSGWFMKAADYMAETLADVAFVSTNSICQGI
QVSALWPTLFGEGVEIRFAYQSFKWANLAAKNAGVSVAIIGLTRRSGGTK
QIFIATEDGAVTVRTVSNISPYLVPGDNVLVSPRSKVPDDRAPMQFGNHP
YYANELMLSQDEASVMVGEDARVAELIRPLYGSRESISGTPRVCLWITEK
NLALAQEIPTVWARIEKVRKDRKTKTKDVQAKKLVETPWRFRDQYEAKSS
LLVVPIVSSENRPYLPLVLLSKEAVVHNKAFALYDAPLWNFALIASKMHL
VWVAAVCVRLEMRYSYSNTLGWNTFPVPTLTEQNKADLTRCAEDILLARE
SHYPATIADLYDPEKMPDDLRRAHERNDEVLERIYIGRRFRNDTERLEKL
FDLYTKMTAGQGKPKKKVKK
Show or not Domain decomposition
 
XFF4834R

YP_363896.1 lcl|XCV2165

1

809

S=2635 I=61 E=0

putative DNA methylase

XFF4834R

NP_637468.1 lcl|XCC2104

544

812

S=1290 I=89 E=9.71867e-149

hypothetical protein

Iprscan [coil]

215

236

-

Iprscan [G3DSA:3.40.50.150]

239

499

-

Iprscan IPR003356 [PF02384]

238

322

DNA methylase, adenine-specific

Iprscan [seg]

297

308

-

Iprscan [seg]

617

629

-

Iprscan [seg]

813

820

-

Iprscan [SSF53335]

230

393

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TRaBUNYu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr13550.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr13550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr13550.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr13550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cspD XFF4834R_chr31640
XFF4834R_chr31630
XFF4834R_chr31630
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31650
XFF4834R_chr31650
ID cspD
AC XFF4834R_chr31640
LT XFF4834R_chr31640
OR XFF4834R_chr from 3634186 to 3634392 on strand -
DE cold shock protein CspD
IP Cold-shock protein, DNA-binding; Nucleic acid-binding, OB-fold; Cold-shock conserved site
CL 3.1.1 DNA structure level
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: nucleic acid binding (GO:0003676)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN according to GenProtEC : -information transfer- DNA related - DNA replication -- regulation - type of regulation - DNA structure level
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 7293 Da
SQ 68 aa
 
........10........20........30........40........50
| | | | |
MPNGTVKWFNDAKGFGFISPEDGSADVFAHFSAINSKGFRSLQEGQRVSY
DVTQGPKGAQASNITPVE
XFF4834R

XFF4834R_chr30330 lcl|XFF4834R_chr32940711_3484926_r1_XFF4834R-XFF4834R_chr30330

2

67

S=216 I=64 E=9.6059e-21

XFF4834R

XFF4834R_chr24060 lcl|XFF4834R_chr26250841_2774056_r3_XFF4834R-XFF4834R_chr24060

3

64

S=200 I=61 E=7.98539e-19

XFF4834R

XFF4834R_chr23370 lcl|XFF4834R_chr25540883_2704497_f1_XFF4834R-XFF4834R_chr23370

9

52

S=87 I=39 E=4.55689e-05

XFF4834R

YP_363120.1 lcl|scoF-XCV1389

1

68

S=355 I=100 E=5.37917e-37

cold shock protein

XFF4834R

NP_636660.1 lcl|scoF-XCC1286

1

68

S=355 I=100 E=5.37917e-37

cold shock protein

XFF4834R

NP_641672.1 lcl|scoF-XAC1337

1

68

S=355 I=100 E=5.37917e-37

cold shock protein

XFF4834R

YP_363253.1 lcl|cspA-XCV1522

2

67

S=216 I=64 E=3.77464e-20

major cold shock protein

XFF4834R

NP_636795.1 lcl|cspA-XCC1422

2

67

S=216 I=64 E=3.77464e-20

major cold shock protein

XFF4834R

NP_641799.1 lcl|cspA-XAC1465

2

67

S=216 I=64 E=3.77464e-20

major cold shock protein

XFF4834R

lcl|cspA2-XALc_1104

3

67

S=212 I=61 E=1.0653e-19

probable cold-shock protein

XFF4834R

NP_637642.1 lcl|cspA-XCC2287

3

67

S=211 I=63 E=1.48374e-19

major cold shock protein

XFF4834R

lcl|cspA1-XALc_1131

4

67

S=211 I=64 E=1.54985e-19

probable cold shock protein

XFF4834R

YP_364323.1 lcl|cspA-XCV2592

3

67

S=209 I=62 E=2.54754e-19

major cold shock protein

pubmed

1

67

S=259 I=70 E=1.15136e-23

Cold shock protein ; Cytoplasm

Pubmed 17038615

 

prodomImg

pubmed

1

67

S=238 I=64 E=4.28792e-21

Putative uncharacterized protein ; Cytoplasm

Pubmed 18324396

 

prodomImg

pubmed

1

64

S=235 I=64 E=7.96322e-21

CspD ; Cytoplasm

Pubmed 10542339

 

prodomImg

pubmed

1

68

S=235 I=63 E=9.31635e-21

Cold shock-like protein cspD ; Cytoplasm DNA replication inhibitor DNA-binding RNA-binding

Pubmed 2186030

 

prodomImg

pubmed

1

67

S=232 I=61 E=2.04188e-20

CspA ; Cytoplasm

Pubmed 10542339

 

prodomImg

pubmed

1

64

S=231 I=64 E=2.86883e-20

CspE ; Cytoplasm

Pubmed 10542339

 

prodomImg

pubmed

4

67

S=231 I=63 E=2.97064e-20

Strongly similar to cold shock-like protein cspE ; Cytoplasm

Pubmed 16563686

 

prodomImg

pubmed

1

67

S=230 I=64 E=4.10158e-20

CspB ; Cytoplasm

Pubmed 10542339

 

prodomImg

pubmed

1

64

S=228 I=66 E=5.91541e-20

CspC ; Cytoplasm

Pubmed 10542339

 

prodomImg

pubmed

1

66

S=228 I=61 E=7.10397e-20

Cold shock protein ; Cytoplasm

Pubmed 17526788

 

prodomImg

Iprscan IPR012340 [G3DSA:2.40.50.140]

1

67

Nucleic acid-binding, OB-fold

Iprscan IPR012156 [PIRSF002599]

1

68

Cold shock, CspA

Iprscan IPR002059 [PF00313]

1

67

Cold-shock protein, DNA-binding

Iprscan IPR011129 [SM00357]

3

67

Cold shock protein

Iprscan IPR019844 [PS00352]

15

34

Cold-shock conserved site

PD688017

1

34

S=142 I=76 E=9.1719e-10

PD561584

1

64

S=133 I=48 E=1.16982e-08

PDA688Q2

19

67

S=127 I=53 E=6.98799e-08

PDA6S688

6

64

S=117 I=36 E=9.64029e-07

PDA4B0T1

1

68

S=116 I=37 E=1.43969e-06

PDA32184

3

54

S=112 I=43 E=4.35668e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ZG0UCBoF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

187 hits
swiss-prot

Swiss-Prot ncbi-blastp

155 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr31640.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr31640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr31640.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpi6Wn4/XFF4834R_chr31640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.