Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr27760hfqXFF4834R_chr27760probable RNA-binding protein Hfq

hfq XFF4834R_chr27760
XFF4834R_chr27750
XFF4834R_chr27750
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27770
XFF4834R_chr27770
ID hfq
AC XFF4834R_chr27760
LT XFF4834R_chr27760
OR XFF4834R_chr from 3206114 to 3206392 on strand -
DE probable RNA-binding protein Hfq
IP Like-Sm ribonucleoprotein, core; Host factor Hfq
CL 2.3.7 Nucleoproteins, basic proteins
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: RNA binding (GO:0003723)

Curated
PM
AN host factor for RNA phage Q beta replication
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100930)
MW 10146.4 Da
SQ 92 aa
 
........10........20........30........40........50
| | | | |
MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTV
SQMVYKHAISTVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ
Show or not Domain decomposition
 
Hamap HFQ_MF_00436 raw_score=2264 norm_score=24.568

Protein hfq [hfq].

XFF4834R

YP_363499.1 lcl|hfq-XCV1768

1

92

S=476 I=100 E=1.6423e-51

RNA-binding protein Hfq

XFF4834R

NP_642066.1 lcl|hfq-XAC1735

1

92

S=476 I=100 E=1.6423e-51

RNA-binding protein Hfq

XFF4834R

NP_637086.1 lcl|hfq-XCC1716

1

92

S=470 I=99 E=8.533e-51

RNA-binding protein Hfq

XFF4834R

lcl|hfq-XALc_1167

1

91

S=436 I=92 E=1.19488e-46

probable protein hfq (host factorIprotein)

pubmed

1

92

S=339 I=72 E=2.54663e-33

Protein hfq ; DNA-binding RNA-binding Stress response

Pubmed 2020545

 

prodomImg

pubmed

1

68

S=330 I=91 E=2.63481e-32

Protein hfq ; RNA-binding Stress response Virulence

Pubmed 8682778

 

prodomImg

pubmed

1

91

S=328 I=73 E=4.56351e-32

Protein hfq ; RNA-binding Stress response

Pubmed 10074096

 

prodomImg

pubmed

1

68

S=327 I=90 E=5.82533e-32

Hfq ; RNA-binding Stress response

Pubmed 18310023

 

prodomImg

pubmed

1

68

S=327 I=90 E=6.03208e-32

Protein hfq ; RNA-binding Stress response

Pubmed 8825090

 

prodomImg

pubmed

1

87

S=327 I=72 E=6.81519e-32

Protein hfq ; RNA-binding Stress response Virulence

Pubmed 15225327

 

prodomImg

pubmed

1

68

S=325 I=90 E=1.24379e-31

Hfq ; RNA-binding Stress response

Pubmed 15242645

 

prodomImg

pubmed

3

73

S=200 I=49 E=1.6378e-16

Protein hfq ; RNA-binding Stress response Virulence

Pubmed 10564509

 

prodomImg

pubmed

3

70

S=199 I=52 E=2.16486e-16

Protein hfq ; RNA-binding Stress response

Pubmed 8197116

 

prodomImg

pubmed

1

70

S=186 I=51 E=6.95758e-15

Protein hfq ; RNA-binding Stress response

Pubmed 19124572

 

prodomImg

sp_Pdown

sp|Q5GYM1|HFQ_XANOR

1

92

S=476 I=100 E=3.92713e-50

Protein hfq ; RNA-binding Stress response

sp_Pdown

sp|Q2P1M4|HFQ_XANOM

1

92

S=476 I=100 E=3.92713e-50

Protein hfq ; RNA-binding Stress response

sp_Pdown

sp|Q3BUR4|HFQ_XANC5

1

92

S=476 I=100 E=3.92713e-50

Protein hfq ; RNA-binding Stress response

sp_Pdown

sp|Q8PLQ4|HFQ_XANAC

1

92

S=476 I=100 E=3.92713e-50

Protein hfq ; RNA-binding Stress response

sp_Pdown

sp|Q8P9X7|HFQ_XANCP

1

92

S=470 I=99 E=2.04045e-49

Protein hfq ; RNA-binding Stress response

Iprscan [G3DSA:2.30.30.100]

1

76

-

Iprscan [MF_00436]

3

75

-

Iprscan IPR001163 [PF01423]

5

64

Like-Sm ribonucleoprotein, core

Iprscan IPR005001 [TIGR02383]

5

64

Host factor Hfq

PD009059

9

68

S=256 I=81 E=1.45012e-23

PDA1T9I8

69

92

S=122 I=100 E=2.82454e-07

PDA0A179

7

62

S=112 I=37 E=3.99987e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one mtOU8Xgh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

341 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWkGJNk/XFF4834R_chr27760.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWkGJNk/XFF4834R_chr27760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWkGJNk/XFF4834R_chr27760.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWkGJNk/XFF4834R_chr27760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.