Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06020XFF4834R_chr06200797_0676054_f2_XFF4834R-XFF4834R_chr06020XFF4834R_chr06020putative prolyl oligopeptidase family protein

XFF4834R_chr06200797_0676054_f2_XFF4834R-XFF4834R_chr06020 XFF4834R_chr06020
XFF4834R_chr06010
XFF4834R_chr06010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06030
XFF4834R_chr06030
ID XFF4834R_chr06200797_0676054_f2_XFF4834R-XFF4834R_chr06020
AC XFF4834R_chr06020
LT XFF4834R_chr06020
OR XFF4834R_chr from 675797 to 676054 on strand +
DE putative prolyl oligopeptidase family protein
IP
CL 2.3.6 Turnover, degradation GO:0006508
EC
GO InterPro


Curated
PM
AN domaine Dap2: Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] et pfam dit proteolysis, GO:0006508
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101109)
MW 9141.2 Da
SQ 85 aa
 
........10........20........30........40........50
| | | | |
MAARSPLTLAHQIREPVFLAPVARTSARGRTHQTDGARMKGAGVPVESLY
SSNEGNGFYTEPHRCEYDTRVLALLSKQLGGGTAN
Show or not Domain decomposition
 
XFF4834R

YP_362958.1 lcl|XCV1227

1

85

S=195 I=50 E=1.40478e-17

prolyl oligopeptidase family protein

XFF4834R

NP_641536.1 lcl|XAC1200-XAC1200

1

85

S=190 I=49 E=5.66824e-17

prolyl oligopeptidase family protein

PDA1Y6F5

47

84

S=138 I=71 E=3.07333e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one I8Poztqq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBki20n6/XFF4834R_chr06020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBki20n6/XFF4834R_chr06020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBki20n6/XFF4834R_chr06020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBki20n6/XFF4834R_chr06020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.