Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr32840lspAXFF4834R_chr32840probable lipoprotein signal peptidase
  2. XFF4834R_chr37050sppAXFF4834R_chr37050probable protease IV; signal peptide peptidase

lspA XFF4834R_chr32840
XFF4834R_chr32830
XFF4834R_chr32830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32850
XFF4834R_chr32850
ID lspA
AC XFF4834R_chr32840
LT XFF4834R_chr32840
OR XFF4834R_chr from 3781628 to 3782146 on strand -
DE probable lipoprotein signal peptidase
IP Peptidase A8, signal peptidase II
CL 2.3.5 Export, signal peptide cleavage GO:0006605 GO:0006886 GO:0016485
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: membrane (GO:0016020)
Molecular Function: aspartic-type endopeptidase activity (GO:0004190)

Curated
PM
AN
CC COG: [MU] Cell wall/membrane/envelope biogenesis;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100824)
MW 18865.5 Da
SQ 172 aa
 
........10........20........30........40........50
| | | | |
MSQRPNPSALIWLLLSALVVGLDQWSKAWVLSSLPEYTPVPMIDGFWNWY
RTYNTGAAFSFLSDAGGWQLWFFTALAVGISGLLAFWLSRTARGQWRSAL
PYALVIGGAIGNVIDRLMHGHVVDFIQWYIGSHTWPSFNIADSAIVGGAI
GIAVFGLFDKSGKQQAGTGNLR
Show or not Domain decomposition
 
XFF4834R

NP_641591.1 lcl|lspA-XAC1255

1

172

S=803 I=92 E=1.40333e-90

lipoprotein signal peptidase

XFF4834R

NP_636531.1 lcl|lspA-XCC1156

1

167

S=741 I=86 E=3.8025e-83

lipoprotein signal peptidase

XFF4834R

YP_363022.1 lcl|lspA-XCV1291

1

172

S=736 I=91 E=1.52098e-82

lipoprotein signal peptidase

XFF4834R

lcl|lspA-XALc_0923

1

167

S=658 I=75 E=5.07206e-73

probable lipoprotein signal peptidase. transmembrane

pubmed

1

165

S=292 I=40 E=4.07885e-27

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 6378662,6374664

 

prodomImg

pubmed

1

166

S=272 I=39 E=9.99592e-25

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 2403548

 

prodomImg

pubmed

22

143

S=244 I=48 E=2.2629e-21

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 2121716

 

prodomImg

pubmed

6

160

S=242 I=34 E=4.16602e-21

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Pubmed 19187283

 

prodomImg

pubmed

1

142

S=228 I=38 E=2.03471e-19

Putative lipoprotein signal peptidase Putative lipoprotein signal peptidase LspA Putative lipoprotein signal peptide-like protein ; Plasmid

Pubmed 12534468,12426347

 

prodomImg

sp_Pdown

sp|Q8PN18|LSPA_XANAC

1

172

S=803 I=92 E=3.51945e-89

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

sp_Pdown

sp|Q5H2E0|LSPA_XANOR

1

166

S=757 I=89 E=1.28485e-83

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

sp_Pdown

sp|B2STC5|LSPA_XANOP

1

166

S=757 I=89 E=1.28485e-83

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

sp_Pdown

sp|Q2P5A9|LSPA_XANOM

1

166

S=757 I=89 E=1.28485e-83

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

sp_Pdown

sp|Q8PBG5|LSPA_XANCP

1

167

S=741 I=86 E=9.53641e-82

Lipoprotein signal peptidase EC=3.4.23.36 ; Aspartyl protease Cell inner membrane Hydrolase Transmembrane

Iprscan IPR001872 [PR00781]

54

62

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PR00781]

102

117

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PR00781]

138

154

Peptidase A8, signal peptidase II

Iprscan IPR001872 [MF_00161]

7

163

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PF01252]

16

158

Peptidase A8, signal peptidase II

Iprscan IPR001872 [TIGR00077]

1

166

Peptidase A8, signal peptidase II

Iprscan IPR001872 [PS00855]

105

117

Peptidase A8, signal peptidase II

Iprscan [seg]

144

154

-

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [tmhmm]

7

26

-

Iprscan [tmhmm]

67

89

-

Iprscan [tmhmm]

96

118

-

Iprscan [tmhmm]

138

158

-

PD004304

88

143

S=167 I=57 E=8.66557e-13

PDA1L5T0

1

36

S=143 I=75 E=8.34763e-10

PDA1F783

40

93

S=132 I=52 E=1.61799e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Hlaqvt4p)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

381 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr32840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr32840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr32840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr32840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
sppA XFF4834R_chr37050
XFF4834R_chr37040
XFF4834R_chr37040
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37060
XFF4834R_chr37060
ID sppA
AC XFF4834R_chr37050
LT XFF4834R_chr37050
OR XFF4834R_chr from 4284759 to 4286660 on strand -
DE probable protease IV; signal peptide peptidase
IP Peptidase S49; Peptidase S49, SppA
CL 2.3.5 Export, signal peptide cleavage GO:0006605 GO:0006886 GO:0016485
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Biological Process: signal peptide processing (GO:0006465)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: peptidase activity (GO:0008233)

Curated
PM
AN
CC COG: [OU] Posttranslational modification, protein turnover, chaperones;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 68161 Da
SQ 633 aa
 
........10........20........30........40........50
| | | | |
MNHPVRRNPIASFFVGLWDVMNFTRRLIFNLVFFGFLFLLLLVFMVALAR
GDGTKPLAERTTLVINPEGALVEQFSADPVSRSLAKAVGDKSAEEVQLRD
LARVIEAAGKDRKIERVLLNLDKLQPSGFASQREVAAALQKLRASGKQIV
AFSESMSQGQYLLAAQANEVYLDPMGSVLLEGLGRYRQYFREGLQDKLGV
DVHLFRVGEYKSAAEPYILDAASADAKEADLFWMNDVWRRYLADVGTARK
LSPAQLAAGIDTLPEGVAAAGGDLAKFALQQKLVDGLKTREEVDALLVQR
GVADSDADSGFRNIGFNDYLSQLQAQRSPMDSRPQVAVVVAAGEISGGEQ
PAGRIGGESTAALLRQARDDDDVKAVVLRVDSPGGEVFASEQIRREVVAL
KQAGKPVVVSMGDLAASGGYWISMNADRIYADPSTISGSIGIFGMVPNLT
RALDKIGVHTDGVATTRFAGAFDITRPLDPAAGQVIQAVINKGYADFTGK
VAQARHQSVDAIDKVARGRVWSGAQAKERGLVDAFGGMSEAVADAADRAK
LSRGKFRVRYVEKPATPFSQFMSGFAGSHMGAWMLSDSGMARALLARSLP
EVDSQLRFVESAVHDSKASGTPVKSLAYCFCGF
XFF4834R

NP_644119.1 lcl|sppA-XAC3813

1

633

S=3097 I=95 E=0

protease IV

XFF4834R

YP_365669.1 lcl|sppA-XCV3938

1

633

S=3090 I=94 E=0

protease IV

XFF4834R

NP_639106.1 lcl|sppA-XCC3761

1

633

S=2950 I=90 E=0

protease IV

XFF4834R

lcl|SppA-XALc_2870

1

633

S=2442 I=75 E=0

putative periplasmic serine protease protein

XFF4834R

lcl|XALc_0210

373

553

S=141 I=29 E=1.14118e-09

hypothetical phage-related protein

pubmed

10

631

S=996 I=40 E=1.00898e-111

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

Pubmed 3522590

 

prodomImg

pubmed

51

545

S=805 I=38 E=1.64118e-88

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

Pubmed 10675023

 

prodomImg

pubmed

364

536

S=308 I=34 E=2.35159e-28

Putative signal peptide peptidase sppA EC=3.4.21.- ; Cell membrane Hydrolase Protease Transmembrane

Pubmed 9387221

 

prodomImg

pubmed

364

583

S=281 I=34 E=4.35628e-25

Putative signal peptide peptidase sppA EC=3.4.21.- ; Cell membrane Hydrolase Protease Transmembrane

Pubmed 10103244

 

prodomImg

pubmed

405

583

S=255 I=33 E=7.26828e-22

Putative peptidase pfaP EC=3.4.21.- ; Hydrolase Protease Signal

Pubmed 7628708

 

prodomImg

pubmed

335

538

S=245 I=32 E=1.17308e-20

Putative protease

Pubmed 11425734

 

prodomImg

pubmed

374

551

S=234 I=31 E=2.56891e-19

Peptidase ; Plasmid

Pubmed 18070959

 

prodomImg

pubmed

358

553

S=214 I=30 E=5.57215e-17

PspA

Pubmed 8793884

 

prodomImg

pubmed

334

441

S=202 I=43 E=1.68479e-15

Probe 6 protein

Pubmed 11805055

 

prodomImg

pubmed

331

563

S=199 I=29 E=4.17199e-15

Probable protease sohB EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

Pubmed 1885549

 

prodomImg

sp_Pdown

sp|P08395|SPPA_ECOLI

10

631

S=996 I=40 E=6.94613e-112

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

sp_Pdown

sp|P45243|SPPA_HAEIN

51

545

S=805 I=38 E=1.12985e-88

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

sp_Pdown

sp|P73689|SPPA_SYNY3

81

564

S=687 I=37 E=1.96818e-74

Protease 4 homolog EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

sp_Pdown

sp|O34525|SPPA_BACSU

364

536

S=308 I=34 E=1.61891e-28

Putative signal peptide peptidase sppA EC=3.4.21.- ; Cell membrane Hydrolase Protease Transmembrane

sp_Pdown

sp|Q55682|Y021_SYNY3

375

574

S=296 I=36 E=5.82744e-27

Putative protease slr0021 EC=3.4.21.- ; Hydrolase

Iprscan IPR004634 [PIRSF001217]

1

633

Peptidase S49, protease IV

Iprscan IPR002142 [PF01343]

141

256

Peptidase S49

Iprscan IPR002142 [PF01343]

399

552

Peptidase S49

Iprscan IPR004634 [TIGR00705]

18

609

Peptidase S49, protease IV

Iprscan IPR004635 [TIGR00706]

335

550

Peptidase S49, SppA

Iprscan [seg]

27

48

-

Iprscan [seg]

369

372

-

Iprscan [tmhmm]

27

49

-

PD277456

550

633

S=346 I=74 E=2.71259e-34

PD397638

96

229

S=324 I=47 E=1.21321e-31

PD397638

364

486

S=113 I=29 E=4.28042e-06

PD446121

320

363

S=214 I=100 E=2.63032e-18

PD589659

233

319

S=194 I=45 E=5.8057e-16

PD002897

400

446

S=168 I=66 E=8.27967e-13

PDA9T6D8

404

534

S=159 I=39 E=1.32471e-11

PDA1Y028

1

26

S=154 I=96 E=5.11717e-11

PD041040

10

92

S=133 I=38 E=1.51921e-08

PDA1G3C5

452

487

S=130 I=69 E=3.53923e-08

PD007574

358

401

S=113 I=55 E=4.62983e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one iKeGbIU2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

19 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr37050.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr37050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr37050.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrBsqfw/XFF4834R_chr37050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.