Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr05290XFF4834R_chr05400667_0594996_r1_XFF4834R-XFF4834R_chr05290XFF4834R_chr0529023S rRNA-associated protein
  2. XFF4834R_chr07760mraWXFF4834R_chr07760Probable S-adenosyl-L-methionine-dependent methyltransferase, MraW
  3. XFF4834R_chr21190rlmNXFF4834R_chr21190probable ribosomal RNA large subunit methyltransferase N
  4. XFF4834R_chr29190rlmLXFF4834R_chr29190Ribosomal RNA large subunit methyltransferase L

XFF4834R_chr05400667_0594996_r1_XFF4834R-XFF4834R_chr05290 XFF4834R_chr05290
XFF4834R_chr05280
XFF4834R_chr05280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr05300
XFF4834R_chr05300
ID XFF4834R_chr05400667_0594996_r1_XFF4834R-XFF4834R_chr05290
AC XFF4834R_chr05290
LT XFF4834R_chr05290
OR XFF4834R_chr from 594667 to 595056 on strand -
DE 23S rRNA-associated protein
IP
CL 2.2.6 rRNA, stable RNA GO:0016072
EC
GO InterPro


Curated
PM
AN Crystal structure of the conserved hypothetical cytosolic protein Xcc0516 from Xanthomonas campestris reveals a novel quaternary structure assembled by five four-helix bundles. PMID: 16948161. 20 codons added to correspond to Xcc0516 protein.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100701)
MW 14570.2 Da
SQ 129 aa
 
........10........20........30........40........50
| | | | |
VENGESAKRPHERLEAWRDSMELVEMIYRFTDVFPEQERYGLTAQLRRAA
VSVPSNIAEGAARRSTPDYARFLSIARGSLSELDTQIQIAVRLGYSNTED
EDIVSRQVDQVFAKLTALMNALRRRGAAP
XFF4834R

NP_635908.1 lcl|XCC0516

1

128

S=575 I=86 E=3.13244e-63

hypothetical protein

XFF4834R

NP_640884.1 lcl|XAC0531-XAC0531

1

103

S=516 I=96 E=5.39379e-56

hypothetical protein

XFF4834R

YP_362295.1 lcl|XCV0564

5

124

S=365 I=57 E=1.05804e-37

hypothetical protein

pubmed

14

125

S=265 I=49 E=3.77837e-24

S23 ribosomal protein

Pubmed 19643902

 

prodomImg

pubmed

14

95

S=201 I=46 E=2.28335e-16

Predicted 23s rRNA protein

Pubmed 15997700

 

prodomImg

pubmed

12

128

S=177 I=35 E=1.69333e-13

S23 ribosomal protein

Pubmed 11598064,16484211

 

prodomImg

pubmed

9

95

S=152 I=39 E=1.9251e-10

Putative uncharacterized protein

Pubmed 8341711

 

prodomImg

pubmed

12

97

S=147 I=35 E=7.11915e-10

23Sr RNA gene

Pubmed 7751314

 

prodomImg

Iprscan [PF05635]

10

117

-

PD009221

9

66

S=180 I=55 E=2.60371e-14

PDA1G770

68

123

S=127 I=43 E=6.64292e-08

PD954966

45

94

S=105 I=52 E=3.2136e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ygx9NhMa)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr05290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr05290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr05290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr05290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
mraW XFF4834R_chr07760
XFF4834R_chr07750
XFF4834R_chr07750
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07770
XFF4834R_chr07770
ID mraW
AC XFF4834R_chr07760
LT XFF4834R_chr07760
OR XFF4834R_chr from 896110 to 897153 on strand +
DE Probable S-adenosyl-L-methionine-dependent methyltransferase, MraW
IP S-adenosyl-L-methionine-dependent methyltransferase, MraW
CL 2.2.6 rRNA, stable RNA GO:0016072
EC
GO InterPro
Molecular Function: methyltransferase activity (GO:0008168)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100819)
MW 36954.4 Da
SQ 347 aa
 
........10........20........30........40........50
| | | | |
MRGEAQPGHPVSQSPAAHVPVLYTQVLDGLQVTENGTYLDGTFGRGGHAR
GVLEHLGPGGRLLVMDKDPDAIAVAEHSFGGDARVSIHRGSFAGLGQVVA
AATVDGILLDLGVSSPQLDVAGRGFSFGKDGPLDMRMDPDSGQSAAEWLA
QASDREIADVLWTYGEERQSRRIARAIVARRAEQPLLRTAQLADLIASVM
PRGDSKTHPATRSFQAIRIHINRELADLEAGLDAALGALKPGGRLAVISF
HSLEDRIVKQFMARYAKAPPSNRRLPEAQPFVATLQLVSGAIKADDAELH
VNPRARSAVLRVAEKLGFGIQDSGLERRSARIPNPQSPIPASPGDAQ
XFF4834R

YP_362554.1 lcl|mraW-XCV0823

11

347

S=1500 I=88 E=1.22932e-174

S-adenosyl-methyltransferase MraW

XFF4834R

NP_641124.1 lcl|mraW-XAC0772

11

346

S=1447 I=85 E=2.97654e-168

S-adenosyl-methyltransferase MraW

XFF4834R

NP_636109.1 lcl|mraW-XCC0718

11

346

S=1395 I=82 E=5.64596e-162

S-adenosyl-methyltransferase MraW

XFF4834R

lcl|MraW-XALc_2821

1

329

S=1188 I=73 E=6.93617e-137

putative s-adenosyl-methyltransferase protein

pubmed

18

315

S=692 I=49 E=4.43021e-75

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

Pubmed 2187182,1630901

 

prodomImg

pubmed

18

315

S=692 I=49 E=4.43021e-75

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

Pubmed 19786035

 

prodomImg

pubmed

17

318

S=686 I=48 E=1.90008e-74

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

Pubmed 12153713

 

prodomImg

pubmed

9

317

S=668 I=47 E=2.9334e-72

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

Pubmed 19447908

 

prodomImg

pubmed

18

315

S=658 I=48 E=4.73441e-71

S-adenosyl-methyltransferase

Pubmed 20028823

 

prodomImg

sp_Pdown

sp|Q3BXF9|RSMH_XANC5

11

347

S=1500 I=88 E=3.50748e-173

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|B2SNY6|RSMH_XANOP

11

347

S=1477 I=86 E=1.93386e-170

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q2NZB1|RSMH_XANOM

11

347

S=1477 I=86 E=1.93386e-170

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q5GW34|RSMH_XANOR

11

347

S=1467 I=86 E=3.28881e-169

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q8PPB5|RSMH_XANAC

11

346

S=1447 I=85 E=8.49263e-167

Ribosomal RNA small subunit methyltransferase H EC=2.1.1.- ; Cytoplasm rRNA processing S-adenosyl-L-methionine

Iprscan [G3DSA:3.40.50.150]

9

321

-

Iprscan IPR002903 [MF_01007]

15

316

S-adenosyl-L-methionine-dependent methyltransferase, MraW

Iprscan IPR002903 [PIRSF004486]

13

318

S-adenosyl-L-methionine-dependent methyltransferase, MraW

Iprscan IPR002903 [PTHR11265]

33

318

S-adenosyl-L-methionine-dependent methyltransferase, MraW

Iprscan IPR002903 [PF01795]

17

315

S-adenosyl-L-methionine-dependent methyltransferase, MraW

Iprscan IPR002903 [TIGR00006]

12

316

S-adenosyl-L-methionine-dependent methyltransferase, MraW

Iprscan [seg]

171

182

-

Iprscan [seg]

224

239

-

PD579631

20

125

S=238 I=50 E=2.01863e-21

PD663474

18

259

S=218 I=28 E=6.2057e-19

PD004685

240

316

S=190 I=55 E=1.36859e-15

PDA7W9R5

18

88

S=175 I=52 E=9.9824e-14

PD681949

130

220

S=171 I=45 E=2.60466e-13

PDA22876

39

164

S=148 I=34 E=2.05318e-10

PDA14203

18

130

S=139 I=31 E=2.40005e-09

PDA3L1Y2

317

347

S=124 I=81 E=1.56299e-07

PDA4C839

10

83

S=115 I=40 E=1.77988e-06

PD737535

243

316

S=109 I=35 E=1.10096e-05

Iprscan [SSF81799]

122

221

-

Iprscan [SSF53335]

12

316

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JbCRTI1R)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

83 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr07760.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr07760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr07760.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr07760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rlmN XFF4834R_chr21190
XFF4834R_chr21180
XFF4834R_chr21180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21200
XFF4834R_chr21200
ID rlmN
AC XFF4834R_chr21190
LT XFF4834R_chr21190
OR XFF4834R_chr from 2458899 to 2460104 on strand +
DE probable ribosomal RNA large subunit methyltransferase N
IP Ribosomal RNA large subunit methyltransferase RlmN;; Radical SAM
CL 2.2.6 rRNA, stable RNA GO:0016072
EC
GO InterPro
Biological Process: rRNA processing (GO:0006364)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: iron-sulfur cluster binding (GO:0051536)
Molecular Function: RNA methyltransferase activity (GO:0008173)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100924)
MW 44914 Da
SQ 401 aa
 
........10........20........30........40........50
| | | | |
MNEVVIPSVLQDGSVRPPEPRKQNLLDLDREGLERFFADTLGEARYRAHQ
VMKWIHHRYVTDFDQMTDLGKALRAKLHQHAEVLVPNVVFDKPSADGTHK
WLLAMGTDGKNAIETVYIPDKGRGTLCVSSQVGCGLNCTFCSTATQGFNR
NLTTAEIIGQVWVAARHLGNVPHQQRRLTNVVMMGMGEPLMNFDNVVRAM
SVMRDDLGYGLASKRVTLSTSGLVPMIDRLSTESDVSLAVSLHAANDALR
ESLVPLNKKYPIAELMESCARYLRGSKKRDSVTFEYTLMKGINDQPEHAR
QLARLMRQFDNAVQSKDAGKVNLIPFNPFPGTRYERSGETEIRAFQKILL
DAQVLTMVRRTRGDDIDAACGQLKGQVMDRTRRQAEFRRTLEGQADRDAA
A
Hamap RLMN_MF_01849 raw_score=7441 norm_score=38.867

Ribosomal RNA large subunit methyltransferase N [rlmN].

XFF4834R

NP_642342.1 lcl|XAC2016-XAC2016

1

401

S=2145 I=99 E=0

hypothetical protein

XFF4834R

YP_363798.1 lcl|XCV2067

1

401

S=2131 I=99 E=0

radical SAM superfamily protein

XFF4834R

NP_637347.1 lcl|XCC1982

1

401

S=2073 I=97 E=0

hypothetical protein

XFF4834R

lcl|XALc_1591

1

399

S=1913 I=88 E=0

conserved hypothetical protein 48

pubmed

22

387

S=1100 I=57 E=1.43476e-124

Ribosomal RNA large subunit methyltransferase N 2 EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L

Pubmed 8973346

 

prodomImg

pubmed

22

395

S=1014 I=53 E=4.34337e-114

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Antibiotic resistance Cytoplasm Iron Iron-sulfur Metal-binding rRNA proces

Pubmed 7926684

 

prodomImg

pubmed

24

394

S=752 I=43 E=2.08696e-82

Predicted FeS cluster redox protein

Pubmed 18028413

 

prodomImg

pubmed

42

373

S=717 I=44 E=4.25164e-78

Putative uncharacterized protein

Pubmed 14617179

 

prodomImg

pubmed

22

373

S=704 I=41 E=1.50396e-76

Putative uncharacterized protein

Pubmed 14617179

 

prodomImg

pubmed

19

373

S=693 I=40 E=3.68879e-75

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

Pubmed 17038625

 

prodomImg

pubmed

42

376

S=626 I=38 E=4.59655e-67

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

Pubmed 12949193

 

prodomImg

pubmed

42

375

S=607 I=40 E=8.23005e-65

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

Pubmed 18441057

 

prodomImg

pubmed

42

375

S=605 I=40 E=1.62461e-64

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

Pubmed 18812508

 

prodomImg

pubmed

42

375

S=595 I=39 E=2.64504e-63

Florfenicol resistance protein

Pubmed 12446909

 

prodomImg

sp_Pdown

sp|Q8PKZ1|RLMN_XANAC

1

401

S=2149 I=100 E=0

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q3BTW5|RLMN_XANC5

1

401

S=2133 I=99 E=0

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q5GZT3|RLMN_XANOR

1

401

S=2108 I=98 E=0

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|B2SMB3|RLMN_XANOP

1

401

S=2108 I=98 E=0

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q2P2T0|RLMN_XANOM

1

401

S=2108 I=98 E=0

Ribosomal RNA large subunit methyltransferase N EC=2.1.1.- ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding rRNA processing S-adenosyl-L-methionine

Iprscan IPR004383 [MF_01849]

24

378

Ribosomal RNA large subunit methyltransferase RlmN;

Iprscan IPR004383 [PIRSF006004]

9

389

Ribosomal RNA large subunit methyltransferase RlmN;

Iprscan IPR007197 [PF04055]

128

303

Radical SAM

Iprscan IPR004383 [TIGR00048]

20

385

Ribosomal RNA large subunit methyltransferase RlmN;

PD336815

134

205

S=261 I=64 E=4.01092e-24

PD306250

46

133

S=248 I=55 E=1.28906e-22

PDA1O2G6

134

217

S=200 I=44 E=8.73959e-17

PD007453

323

388

S=174 I=57 E=1.47094e-13

PDA1S8P9

1

40

S=153 I=80 E=4.29149e-11

PDA9G4T2

128

373

S=152 I=24 E=5.82285e-11

PDA1U7A3

376

401

S=126 I=100 E=7.54472e-08

PD006794

266

307

S=119 I=48 E=6.55687e-07

PDA1F8F4

236

265

S=116 I=70 E=1.568e-06

PDA1K7K4

202

260

S=115 I=38 E=2.03677e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OC7eSzDy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

37 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr21190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr21190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr21190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr21190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rlmL XFF4834R_chr29190
XFF4834R_chr29180
XFF4834R_chr29180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29200
XFF4834R_chr29200
ID rlmL
AC XFF4834R_chr29190
LT XFF4834R_chr29190
OR XFF4834R_chr from 3354857 to 3356992 on strand -
DE Ribosomal RNA large subunit methyltransferase L
IP Putative RNA methylase; DNA methylase, N-6 adenine-specific, conserved site
CL 2.2.6 rRNA, stable RNA GO:0016072
EC
GO InterPro
Biological Process: methylation (GO:0032259)
Molecular Function: methyltransferase activity (GO:0008168)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 78280.1 Da
SQ 711 aa
 
........10........20........30........40........50
| | | | |
MKFFASCAKGLEYLLADELLALGASKATATISGVNVEGELRDAQRAVLWS
RLASRVLWPLTEFDCPDEDALYAGVAELSWDAHLSVGHTLSVDAHVSGTA
ITHARYAAQRIKDAVVDTMRRQGLERPSVDVDNPDLRLNLSLRKGRATIS
VDLGGGPLHRRGWRMAQNEAPLKENLAAAVLMRGGWPRAYADGGGLLDPM
CGSGTLLIEGALMAADVAPGLQRYGSDVPSRWRGFDRDGWQQLVGEARER
DSVGRAALKQVIHGSDMDPHAIRAAKENAQVAGVAEAIWFGVREVGELQT
PPQAAGVVVCNPPYDERLAADAALYRRLGDTLQRVVPQWRASLLCGNAEL
AYATGLRAGKKYQLFNGAIECALIVCEPIAVPRRTPLAAPTALSEGAQMV
ANRLRKNLQKFKKWRAREGIECFRAYDADLPEYSAAIDVYQQAGGDRRIF
LHVQEYAAPATIPEADVRRRLNELLAAAREVFEVPAERVALKSRERGKGG
SKYGRFEQRNEIVHVREHGALLRVNLFDYLDTGLFLDHRPLRGTMAQQCR
GRRFLNLFCYTGVASVEAAVAGAASTTSVDLSATYLQWCADNLALNGLAG
SKHKLVQADALAWLEAERAHFDVIFCDPPTFSNSARAEDFDIQREHVRLL
RAAVARLAPGGVLYFSNNFRRFKLDEDGVAEFAQCEEISPRTIDPDFERH
ARIHRAWRLTA
XFF4834R

XFF4834R_chr42880 lcl|rlmI-XFF4834R_chr42880

515

663

S=107 I=25 E=4.22615e-06

23S rRNA m(5)C1962 methyltransferase, SAM-dependent

XFF4834R

NP_641926.1 lcl|XAC1594-XAC1594

1

711

S=3305 I=89 E=0

23S rRNA m(2)G2445 methyltransferase

XFF4834R

YP_363366.1 lcl|XCV1635

1

711

S=3279 I=88 E=0

23S rRNA m(2)G2445 methyltransferase

XFF4834R

NP_636916.2 lcl|XCC1545

1

711

S=3216 I=86 E=0

23S rRNA m(2)G2445 methyltransferase

XFF4834R

lcl|XALc_1976

1

709

S=2551 I=68 E=0

putative rna methylase protein

XFF4834R

NP_644658.1 lcl|XAC4364-XAC4364

515

663

S=104 I=24 E=3.94109e-05

oxidoreductase

XFF4834R

YP_366207.1 lcl|XCV4476

515

632

S=104 I=27 E=4.45274e-05

hypothetical protein

pubmed

3

707

S=1266 I=41 E=2.72832e-144

Ribosomal RNA large subunit methyltransferase L EC=2.1.1.52 ; Cytoplasm RNA-binding rRNA processing S-adenosyl-L-methionine

Pubmed 16995898

 

prodomImg

pubmed

3

379

S=374 I=30 E=3.21022e-36

Tou5 ; Methyltransferase

Pubmed 10844690

 

prodomImg

pubmed

34

371

S=370 I=30 E=8.74948e-36

Putative RNA methyltransferase ypsC EC=2.1.1.-

Pubmed 8760912

 

prodomImg

pubmed

3

379

S=360 I=30 E=1.30557e-34

Tou5 ; Methyltransferase

Pubmed 10844690

 

prodomImg

pubmed

34

371

S=347 I=30 E=5.35612e-33

Nucleic acid methylase ; Methyltransferase

Pubmed 15317783

 

prodomImg

pubmed

517

668

S=169 I=29 E=2.01537e-11

Putative uncharacterized protein

Pubmed 15882423

 

prodomImg

pubmed

515

668

S=137 I=24 E=1.68723e-07

Putative uncharacterized protein

Pubmed 16549667

 

prodomImg

sp_Pdown

sp|Q8PM40|RLML_XANAC

1

711

S=3305 I=89 E=0

Ribosomal RNA large subunit methyltransferase L EC=2.1.1.52 ; Cytoplasm RNA-binding rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q3BV47|RLML_XANC5

1

711

S=3279 I=88 E=0

Ribosomal RNA large subunit methyltransferase L EC=2.1.1.52 ; Cytoplasm RNA-binding rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|B2SIS8|RLML_XANOP

1

711

S=3248 I=87 E=0

Ribosomal RNA large subunit methyltransferase L EC=2.1.1.52 ; Cytoplasm RNA-binding rRNA processing S-adenosyl-L-methionine

sp_Pdown

sp|Q2P309|RLML_XANOM

1

711

S=3248 I=87 E=0

Ribosomal RNA large subunit methyltransferase L EC=2.1.1.52 ; Cytoplasm RNA-binding rRNA processing S-adenosyl-L-methionine

Iprscan [G3DSA:3.40.50.150]

532

668

-

Iprscan IPR017244 [MF_01858]

3

711

S-adenosyl-L-dependent RNA methyltransferase, bacteria,

Iprscan IPR017244 [PIRSF037618]

1

711

S-adenosyl-L-dependent RNA methyltransferase, bacteria,

Iprscan IPR004114 [PF02926]

67

153

THUMP

Iprscan IPR000241 [PF01170]

161

375

Putative RNA methylase

Iprscan IPR016065 [PF03602]

532

686

Protein of unknown function methylase putative

Iprscan IPR002052 [PS00092]

308

314

DNA methylase, N-6 adenine-specific, conserved site

Iprscan IPR000241 [PS01261]

198

209

Putative RNA methylase

Iprscan IPR004114 [PS51165]

42

153

THUMP

Iprscan [seg]

10

24

-

Iprscan [seg]

317

328

-

Iprscan [seg]

468

480

-

Iprscan [seg]

561

579

-

Iprscan [seg]

647

658

-

PD699301

151

219

S=223 I=62 E=2.29396e-19

PDA1T5B2

220

261

S=205 I=93 E=3.86412e-17

PD862117

350

398

S=201 I=78 E=1.00825e-16

PDA3J1H2

49

186

S=142 I=25 E=1.56365e-09

PD468618

262

353

S=134 I=34 E=1.52201e-08

PDA1F8X0

111

152

S=128 I=52 E=8.18865e-08

PD732520

667

710

S=126 I=47 E=1.39376e-07

PD334310

609

663

S=121 I=41 E=5.38391e-07

PD808492

33

153

S=117 I=24 E=1.76223e-06

PD653581

398

434

S=112 I=73 E=6.51686e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6zBhQ8ID)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

240 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr29190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr29190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr29190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvBptbm/XFF4834R_chr29190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.