Xanthomonas fuscans subsp. fuscans

9 hits

  1. XFF4834R_chr04900rppHXFF4834R_chr04900RNA pyrophosphohydrolase
  2. XFF4834R_chr05340XFF4834R_chr05450074_0601861_r3_XFF4834R-XFF4834R_chr05340XFF4834R_chr05340putative extracellular ribonuclease
  3. XFF4834R_chr10700rnhAXFF4834R_chr10700ribonuclease H
  4. XFF4834R_chr18620rngXFF4834R_chr18620probable ribonuclease G
  5. XFF4834R_chr21450ornXFF4834R_chr21450probable oligoribonuclease
  6. XFF4834R_chr29430rntXFF4834R_chr29430probable ribonuclease T (RNase T)
  7. XFF4834R_chr30900rnhBXFF4834R_chr30900probable ribonuclease HII
  8. XFF4834R_chr31290XFF4834R_chr33910785_3598132_r3_XFF4834R-XFF4834R_chr31290XFF4834R_chr31290putative endoribonuclease L-PSP
  9. XFF4834R_chr31760rncXFF4834R_chr31760RNase III

rppH XFF4834R_chr04900
XFF4834R_chr04900
XFF4834R_chr04900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0540
XFF4834R_chr_0540
ID rppH
AC XFF4834R_chr04900
LT XFF4834R_chr04900
OR XFF4834R_chr from 553159 to 553776 on strand +
DE RNA pyrophosphohydrolase
IP NUDIX hydrolase domain; NUDIX hydrolase, conserved site
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN
CC COG: [LR] Replication, recombination and repair;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 23674.8 Da
SQ 205 aa
 
........10........20........30........40........50
| | | | |
MIDPDGFRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDETPVEAM
YRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWF
LLQFTGDESHLKLDHTDTPEFDHWRWVDFWYPVEHVVMFKRGVYARALRH
LAPLAQSLAGPAAVGAMPERALEAWLPGSSAAGHDSPRKRPRKRNGARAM
RINND
Hamap RPPH_MF_00298 raw_score=4560 norm_score=36.554

RNA pyrophosphohydrolase [rppH].

X.species

NP_640844.1 lcl|nudH-XAC0491

1

205

S=1081 I=100 E=3.0857e-124

dinucleoside polyphosphate hydrolase

X.species

YP_362256.1 lcl|nudH-XCV0525

1

205

S=1075 I=99 E=2.06448e-123

dinucleoside polyphosphate hydrolase

X.species

NP_635872.1 lcl|nudH-XCC0480

1

205

S=969 I=94 E=1.40371e-110

dinucleoside polyphosphate hydrolase

X.species

lcl|nudH-XALc_0294

1

205

S=836 I=83 E=1.51126e-94

probable (di)nucleoside polyphosphate hydrolase protein

pubmed

1

153

S=512 I=61 E=1.20335e-53

RNA pyrophosphohydrolase EC=3.6.1.-

Pubmed 10051655

 

prodomImg

pubmed

1

157

S=427 I=51 E=1.99605e-43

Nudix hydrolase

Pubmed 16177332

 

prodomImg

pubmed

4

153

S=270 I=40 E=2.08826e-24

Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase EC=3.6.1.17

Pubmed 9425114,11183782

 

prodomImg

pubmed

4

153

S=266 I=40 E=6.15619e-24

AT5g06340/MHF15_14 At1g79500/T8K14_8 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase-like protein

Pubmed 9405937

 

prodomImg

pubmed

4

157

S=265 I=40 E=8.49987e-24

Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase EC=3.6.1.17

Pubmed 9714569

 

prodomImg

pubmed

7

156

S=253 I=34 E=3.00672e-22

RNA pyrophosphohydrolase EC=3.6.1.-

Pubmed 18550617

 

prodomImg

pubmed

7

156

S=251 I=34 E=5.02918e-22

RNA pyrophosphohydrolase EC=3.6.1.- ; Magnesium Zinc

Pubmed 12096117

 

prodomImg

pubmed

5

152

S=247 I=35 E=1.5897e-21

RNA pyrophosphohydrolase EC=3.6.1.-

Pubmed 15780005

 

prodomImg

pubmed

7

144

S=233 I=35 E=7.49809e-20

Nudix hydrolase

Pubmed 12096117

 

prodomImg

pubmed

7

144

S=229 I=35 E=2.02587e-19

Nudix hydrolase

Pubmed 12096117

 

prodomImg

sp

1

205

S=1081 I=100 E=7.54456e-123

RNA pyrophosphohydrolase EC=3.6.1.-

 

prodomImg

sp

1

205

S=1075 I=99 E=5.04768e-122

RNA pyrophosphohydrolase EC=3.6.1.-

 

prodomImg

sp

1

205

S=1060 I=98 E=3.17455e-120

RNA pyrophosphohydrolase EC=3.6.1.-

 

prodomImg

sp

1

205

S=1060 I=98 E=3.17455e-120

RNA pyrophosphohydrolase EC=3.6.1.-

 

prodomImg

sp

1

205

S=969 I=94 E=3.43208e-109

RNA pyrophosphohydrolase EC=3.6.1.-

 

prodomImg

Iprscan IPR000086 [G3DSA:3.90.79.10]

3

155

NUDIX hydrolase domain

Iprscan [PTHR22769]

13

70

-

Iprscan [PTHR22769]

13

70

-

Iprscan IPR000086 [PF00293]

7

150

NUDIX hydrolase domain

Iprscan IPR020084 [PS00893]

38

59

NUDIX hydrolase, conserved site

PD012460

91

158

S=230 I=62 E=2.17282e-20

PD694138

158

205

S=146 I=83 E=3.00113e-10

PDA150W2

57

89

S=105 I=61 E=3.26089e-05

Iprscan IPR015797 [SSF55811]

1

151

NUDIX hydrolase domain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one GhnjUzih)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

300 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr04900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr04900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr04900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr04900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr05450074_0601861_r3_XFF4834R-XFF4834R_chr05340 XFF4834R_chr05340
XFF4834R_chr05340
XFF4834R_chr05340
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0588
XFF4834R_chr_0588
ID XFF4834R_chr05450074_0601861_r3_XFF4834R-XFF4834R_chr05340
AC XFF4834R_chr05340
LT XFF4834R_chr05340
OR XFF4834R_chr from 600074 to 601861 on strand -
DE putative extracellular ribonuclease
IP Endonuclease I
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Molecular Function: nuclease activity (GO:0004518)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20100408)
MW 61147.3 Da
SQ 595 aa
 
........10........20........30........40........50
| | | | |
MRLPSRFVSLRCTLPLACAFALGATSADAAVFINELHYDDAGASGDSGEG
VEVVATAGESLSGYRIYLYNGAAPSAAVVYANTAVPAGTVVSCGSQVRLA
TVSYASNGVQNGPNDGVALVDPNGQLVQFLSYEGAITGSGGPAAGVTSQN
LPVSESNSTAVGSSLQLTGTGSSAANFSWAGSAAQTFGACNRGQTFTGSD
GGGSTGAPTISSTTPTQGATGFPAAGDLAVGFSEAVTLGSGAFALSCASS
GNVALTYPTSGTRFTLSTNTALVGGERCTLAITASAIRDASGLSPAANQS
IAFTVATASGGTGYYARVNTANASQLRCSLHATIKGHTVYPYSGSGTSTW
TILEMADEDPNNSGRILDAYRNRSYAKVSDRAGTGSGLTYNREHTWPNSL
GFGSATGDRGLPYAPYTDTHMLYLTDTSFNADRGNKPYATCTSSCGERVT
EVNDGSGGGSGRYPGNSNWVRTPDGNSGTFEVWGRRKGDMARAVMYMAIR
YDGGLDATTGQSEPDLELTDDRSKIVQTSASPAYMGLLSTLLAWHQADPP
DDAERARNEVIFSFQGNRNPFVDHPEWATASLFNSARPASCQLAN
X.species

NP_640893.2 lcl|XAC0540-XAC0540

1

595

S=2782 I=90 E=0

ribonuclease

X.species

YP_362300.1 lcl|XCV0569

1

595

S=2775 I=90 E=0

putative extracellular ribonuclease

X.species

NP_635913.2 lcl|XCC0521

1

595

S=2599 I=84 E=0

ribonuclease

pubmed

305

578

S=341 I=37 E=2.56321e-32

Extracellular ribonuclease EC=3.1.-.- ; Hydrolase Secreted Signal

Pubmed 1396690

 

prodomImg

sp

305

578

S=341 I=37 E=1.76511e-32

Extracellular ribonuclease EC=3.1.-.- ; Hydrolase Secreted Signal

 

prodomImg

sp

300

578

S=325 I=36 E=1.3101e-30

Extracellular ribonuclease EC=3.1.-.- ; Hydrolase Secreted Signal

 

prodomImg

Iprscan IPR007346 [PF04231]

321

576

Endonuclease I

Iprscan [seg]

39

55

-

Iprscan [seg]

162

173

-

Iprscan [seg]

193

206

-

Iprscan [seg]

455

461

-

PD686330

314

522

S=358 I=44 E=8.13594e-36

PD653035

31

192

S=306 I=45 E=1.55675e-29

PD606878

253

311

S=268 I=93 E=6.04594e-25

PD924553

530

595

S=250 I=70 E=1.03634e-22

PDA21579

448

496

S=221 I=84 E=3.12824e-19

PD918145

497

529

S=156 I=94 E=2.84796e-11

PDA5R0L0

1

30

S=144 I=97 E=6.23672e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one G6aPZRZC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr05340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr05340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr05340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr05340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rnhA XFF4834R_chr10700
XFF4834R_chr10690
XFF4834R_chr10690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10710
XFF4834R_chr10710
ID rnhA
AC XFF4834R_chr10700
LT XFF4834R_chr10700
OR XFF4834R_chr from 1210112 to 1210564 on strand +
DE ribonuclease H
IP Ribonuclease H
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Molecular Function: ribonuclease H activity (GO:0004523)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101103)
MW 16825.9 Da
SQ 150 aa
 
........10........20........30........40........50
| | | | |
MKSIEVHTDGSCLGNPGPGGWAALLRYNGREKELAGGEAVSTNNRMELMA
AIMALETLTEPCQIVLHTDSQYVRQGITEWMPGWVRRNWKTAGGDPVKNR
ELWERLHAATQRHRIDWRWVKGHNGDLDNERVDVLARNQAIAQRGGLATS
Hamap RNH_MF_00042 raw_score=4602 norm_score=35.855

Ribonuclease H [rnhA].

X.species

NP_641428.1 lcl|rnhA-XAC1089

1

150

S=775 I=99 E=2.72471e-87

ribonuclease H

X.species

YP_362820.1 lcl|rnhA-XCV1089

1

150

S=771 I=98 E=8.2453e-87

ribonuclease H

X.species

NP_636365.1 lcl|rnhA-XCC0987

1

150

S=753 I=95 E=1.10719e-84

ribonuclease H

X.species

lcl|rnhA-XALc_0598

1

146

S=658 I=82 E=3.37825e-73

probable ribonuclease h (rnase h) protein

pubmed

1

141

S=476 I=62 E=1.25329e-49

Ribonuclease HI EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 6296074,6316347

 

prodomImg

pubmed

1

141

S=467 I=61 E=1.83778e-48

Ribonuclease HI EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 1650910

 

prodomImg

pubmed

1

143

S=463 I=56 E=5.61004e-48

Ribonuclease HI

Pubmed 11809928

 

prodomImg

pubmed

4

138

S=460 I=64 E=1.21889e-47

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 18700039

 

prodomImg

pubmed

2

140

S=460 I=62 E=1.25119e-47

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 12564983

 

prodomImg

pubmed

4

137

S=443 I=58 E=1.20629e-45

Ribonuclease H EC=3.1.26.4 ; Hydrolase

Pubmed 18459973

 

prodomImg

pubmed

2

143

S=442 I=58 E=1.70967e-45

Ribonuclease H EC=3.1.26.4 ; Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 1653414,1315754

 

prodomImg

pubmed

4

150

S=412 I=55 E=8.121e-42

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 8294019

 

prodomImg

pubmed

4

136

S=379 I=49 E=6.85828e-38

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 17916642

 

prodomImg

pubmed

4

140

S=375 I=50 E=2.22533e-37

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

Pubmed 15618402

 

prodomImg

sp

1

150

S=775 I=99 E=6.00895e-86

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

 

prodomImg

sp

1

150

S=771 I=98 E=1.81838e-85

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

 

prodomImg

sp

1

150

S=761 I=97 E=2.90933e-84

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

 

prodomImg

sp

1

150

S=761 I=97 E=2.90933e-84

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

 

prodomImg

sp

1

150

S=753 I=95 E=2.44175e-83

Ribonuclease H EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Magnesium Metal-binding

 

prodomImg

Iprscan [G3DSA:3.30.420.10]

4

140

-

Iprscan [MF_00042]

1

149

-

Iprscan IPR002156 [PF00075]

1

141

Ribonuclease H

Iprscan IPR002156 [PS50879]

1

141

Ribonuclease H

PD774933

23

73

S=137 I=62 E=4.15017e-09

PD755202

72

140

S=128 I=39 E=4.33147e-08

PD858002

72

111

S=116 I=53 E=1.46684e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one MrCIAF5c)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

27 hits
swiss-prot

Swiss-Prot ncbi-blastp

322 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr10700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr10700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr10700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr10700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rng XFF4834R_chr18620
XFF4834R_chr18610
XFF4834R_chr18610
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18630
XFF4834R_chr18630
ID rng
AC XFF4834R_chr18620
LT XFF4834R_chr18620
OR XFF4834R_chr from 2128935 to 2130434 on strand +
DE probable ribonuclease G
IP Ribonuclease E/G; Nucleic acid-binding, OB-fold-like
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Biological Process: RNA processing (GO:0006396)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: ribonuclease activity (GO:0004540)
Molecular Function: RNA binding (GO:0003723)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100811)
MW 55754.4 Da
SQ 499 aa
 
........10........20........30........40........50
| | | | |
MSEEILVNVTPRETRVAVIENGMLQELHIERGWRRGVVGNIYKGKVQRVM
PGMQAAFVEVGLERAAFLHANDVVRLAPAPASVVDTEETPIPPPPPASVP
IVELLRDGQEIVVQVVKDPIGTKGARLTTQISIPSRYLVLLPQSKVVGVS
ARIEDEAERLRLKTIVSEVSAQHGGFGYIIRTNAEGQPAEALAEDIAYLS
RVWNVVERRGREAPPCSIIYEDLSLPLRAVRDLIRRDVEKVKVDSNETFV
QLQAFVAKYMPVLAERLELYTGDRPIFDLYGVEDEIGRALNKQVPLKSGG
YLVIDQTEAMTTIDVNTGSFVGQRNLEETVFRTNLEAAQAVARQLRLRNL
GGIIIIDFIDMDDPEHRRQVLRTLEKALARDHAKTTVYEFSPLGLVEMTR
KRTVESLERQLSETCGQCGGRGTIKTAETVTYEIFREITRAVRQFDAARL
LVIASSKVVARITDEESAAVAELEEFLGKSIRFQSDDQYLQEQFDVVLL
XFF4834R

XFF4834R_chr22100 lcl|XFF4834R_chr24030710_2557369_r3_XFF4834R-XFF4834R_chr22100

5

499

S=611 I=33 E=2.39473e-67

X.species

NP_643079.2 lcl|rng-XAC2770

1

499

S=2333 I=91 E=0

ribonuclease G

X.species

YP_364658.1 lcl|rng-XCV2927

1

499

S=2329 I=91 E=0

ribonuclease G

X.species

NP_637957.1 lcl|rng-XCC2609

1

499

S=2306 I=90 E=0

ribonuclease G

X.species

lcl|CafA-XALc_2460

1

499

S=2131 I=83 E=0

putative ribonucleases g and e protein

X.species

NP_637449.1 lcl|rne-XCC2084

5

499

S=612 I=32 E=7.1441e-67

ribonuclease E

X.species

NP_642428.1 lcl|rne-XAC2111

5

499

S=611 I=33 E=8.65467e-67

ribonuclease E

X.species

YP_364154.1 lcl|rne-XCV2423

5

499

S=611 I=33 E=1.01253e-66

ribonuclease E

X.species

lcl|rne-XALc_1617

5

499

S=603 I=32 E=9.27214e-66

probable ribonuclease e protein

pubmed

1

499

S=1255 I=51 E=3.60803e-143

Ribonuclease G EC=3.1.26.- ; Cell cycle division Cytoplasm Cytoskeleton Endonuclease Hydrolase

Pubmed 1937035

 

prodomImg

pubmed

5

474

S=576 I=31 E=8.27068e-61

Cell shape determining protein homolog

Pubmed 8320240

 

prodomImg

pubmed

5

478

S=566 I=31 E=1.12126e-59

Putative ribonuclease E

Pubmed 19345289

 

prodomImg

pubmed

267

499

S=560 I=48 E=5.62613e-59

C-terminal reagion of putative cytoplasmic axial filament protein

Pubmed 12406764

 

prodomImg

pubmed

258

499

S=466 I=42 E=1.67232e-47

Cytoplasmic axial filament protein

Pubmed 10024565

 

prodomImg

sp

1

499

S=1255 I=51 E=2.45461e-143

Ribonuclease G EC=3.1.26.- ; Cell cycle division Cytoplasm Cytoskeleton Endonuclease Hydrolase

 

prodomImg

sp

1

499

S=1255 I=51 E=2.45461e-143

Ribonuclease G EC=3.1.26.- ; Cell cycle division Cytoplasm Cytoskeleton Endonuclease Hydrolase

 

prodomImg

sp

1

499

S=1255 I=51 E=2.45461e-143

Ribonuclease G EC=3.1.26.- ; Cell cycle division Cytoplasm Cytoskeleton Endonuclease Hydrolase

 

prodomImg

sp

1

499

S=1255 I=51 E=2.45461e-143

Ribonuclease G EC=3.1.26.- ; Cell cycle division Cytoplasm Cytoskeleton Endonuclease Hydrolase

 

prodomImg

sp

4

499

S=1214 I=50 E=2.69042e-138

Ribonuclease G EC=3.1.26.- ; Cell cycle division Cytoplasm Cytoskeleton Endonuclease Hydrolase

 

prodomImg

Iprscan IPR012340 [G3DSA:2.40.50.140]

30

136

Nucleic acid-binding, OB-fold

Iprscan IPR019307 [PF10150]

132

403

RNA-binding protein AU-1/Ribonuclease E/G

Iprscan IPR003029 [PF00575]

38

129

Ribosomal protein S1, RNA binding domain

Iprscan [SM00316]

37

130

-

Iprscan IPR004659 [TIGR00757]

13

436

Ribonuclease E/G

Iprscan IPR003029 [PS50126]

39

130

Ribosomal protein S1, RNA binding domain

Iprscan [seg]

90

102

-

Iprscan [seg]

335

350

-

Iprscan [seg]

351

363

-

PD007819

175

331

S=401 I=45 E=5.00322e-41

PD383053

1

73

S=272 I=68 E=2.10073e-25

PD716082

424

496

S=206 I=59 E=2.44132e-17

PDA1F6X7

108

144

S=148 I=76 E=2.71839e-10

PDA1E5K4

365

422

S=140 I=52 E=1.9672e-09

PDA1W183

105

206

S=134 I=36 E=1.0492e-08

PDA1G271

304

333

S=133 I=83 E=1.6084e-08

Iprscan IPR016027 [SSF50249]

39

136

Nucleic acid-binding, OB-fold-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one J3GiJPov)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr18620.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr18620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr18620.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr18620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
orn XFF4834R_chr21450
XFF4834R_chr21440
XFF4834R_chr21440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21460
XFF4834R_chr21460
ID orn
AC XFF4834R_chr21450
LT XFF4834R_chr21450
OR XFF4834R_chr from 2487146 to 2487730 on strand +
DE probable oligoribonuclease
IP Polynucleotidyl transferase, ribonuclease H fold; Exonuclease, RNase T/DNA polymerase III
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
Molecular Function: exonuclease activity (GO:0004527)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN
CC COG: [A] RNA processing and modification;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 21929.4 Da
SQ 194 aa
 
........10........20........30........40........50
| | | | |
MAENLAGNDRLIWIDLEMTGLDTDRDSIIEIATIVTDAQLNVLAEGPELA
IAHPLETLEAMDEWNRNQHRRSGLWQRVLDSQVTHAQAEAQTVAFLSEWI
RAGASPMCGNSICQDRRFLHRQMSRLERYFHYRNLDVSTIKELARRWAPT
VANGFAKSSAHTALSDVRDSIDELRHYRQFMGALGGDTQADVPA
X.species

NP_642365.1 lcl|orn-XAC2039

1

192

S=1004 I=98 E=7.87495e-115

oligoribonuclease

X.species

YP_363931.1 lcl|orn-XCV2200

1

181

S=959 I=99 E=1.87536e-109

oligoribonuclease

X.species

NP_637524.1 lcl|orn-XCC2168

1

181

S=938 I=97 E=6.23587e-107

oligoribonuclease

X.species

lcl|orn-XALc_1647

1

186

S=863 I=85 E=8.54542e-98

probable oligoribonuclease protein

pubmed

16

179

S=483 I=52 E=3.17829e-50

Putative oligoribonuclease ; Plasmid

Pubmed 12673061

 

prodomImg

pubmed

8

188

S=439 I=49 E=7.43801e-45

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

Pubmed 10913103

 

prodomImg

pubmed

8

189

S=436 I=49 E=1.64448e-44

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

Pubmed 10540289,10913103

 

prodomImg

pubmed

1

178

S=430 I=44 E=9.24181e-44

Oligoribonuclease, mitochondrial EC=3.1.-.- ; Alternative splicing Exonuclease Hydrolase Manganese Mitochondrion Nucleus Phosphoprotein Transit

Pubmed 10810093

 

prodomImg

pubmed

1

178

S=429 I=45 E=1.27602e-43

Oligoribonuclease, mitochondrial EC=3.1.-.- ; Exonuclease Hydrolase Manganese Mitochondrion Phosphoprotein Transit peptide

Pubmed 17947660

 

prodomImg

sp

1

192

S=1004 I=98 E=2.05003e-113

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

192

S=998 I=98 E=8.79237e-113

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

192

S=998 I=98 E=8.79237e-113

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

181

S=959 I=99 E=4.88199e-108

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

181

S=938 I=97 E=1.62334e-105

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

Iprscan [G3DSA:3.30.420.10]

2

185

-

Iprscan [MF_00045]

6

184

-

Iprscan [PTHR11046]

1

181

-

Iprscan IPR013520 [PF00929]

11

173

Exonuclease, RNase T/DNA polymerase III

Iprscan IPR006055 [SM00479]

10

183

Exonuclease

PD011165

47

159

S=354 I=58 E=1.77067e-35

PD477405

11

46

S=155 I=83 E=2.70735e-11

PDA1T0K4

160

181

S=115 I=100 E=1.66906e-06

Iprscan IPR012337 [SSF53098]

8

185

Polynucleotidyl transferase, ribonuclease H fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RTK1kJHz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

170 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr21450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr21450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr21450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr21450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rnt XFF4834R_chr29430
XFF4834R_chr_3103
XFF4834R_chr_3103
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3105
XFF4834R_chr_3105
ID rnt
AC XFF4834R_chr29430
LT XFF4834R_chr29430
OR XFF4834R_chr from 3378638 to 3379273 on strand +
DE probable ribonuclease T (RNase T)
IP Ribonuclease T; Exonuclease
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Biological Process: RNA processing (GO:0006396)
Cellular Component: intracellular (GO:0005622)
Molecular Function: exonuclease activity (GO:0004527)
Molecular Function: ribonuclease activity (GO:0004540)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101028)
MW 22910.9 Da
SQ 211 aa
 
........10........20........30........40........50
| | | | |
MNEPVDAQPAPSFLPMSRRFRGYLPVVVDVETGGFDWNKHALLEIACVPI
EMGADGRFFPGETASAHLVPAPGLEIDPKSLEITGIVLDHPFRFAKQEKD
ALDHVFAPVRAAVKKYGCQRAILVGHNAHFDLNFLNAAVARVGHKRNPFH
PFSVFDTVTLAGVAYGQTVLARAAQAAGLDWNAADAHSAVYDTEQTARLF
CKIANAWPGPV
Show or not Domain decomposition
 
X.species

NP_641903.1 lcl|rnt-XAC1571

1

211

S=1111 I=100 E=8.74813e-128

ribonuclease T

X.species

YP_363342.1 lcl|rnt-XCV1611

1

211

S=1103 I=99 E=7.87253e-127

ribonuclease T

X.species

NP_636892.1 lcl|rnt-XCC1521

1

210

S=1078 I=97 E=8.95002e-124

ribonuclease T

X.species

lcl|rnt-XALc_1998

1

208

S=931 I=83 E=5.22523e-106

probable ribonuclease t (exoribonuclease t) (rnase t) protein

pubmed

16

207

S=520 I=53 E=1.08458e-54

Rnase T ; Exonuclease Hydrolase tRNA processing

Pubmed 12065505

 

prodomImg

pubmed

16

207

S=499 I=50 E=3.93496e-52

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

Pubmed 1460056

 

prodomImg

pubmed

14

207

S=499 I=49 E=4.52402e-52

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

Pubmed 8021208

 

prodomImg

pubmed

16

207

S=452 I=46 E=1.91545e-46

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

Pubmed 17038625

 

prodomImg

pubmed

14

129

S=215 I=40 E=1.12755e-17

RNase T

Pubmed 8636046

 

prodomImg

pubmed

26

203

S=110 I=30 E=5.45667e-05

DNA polymerase III polC-type EC=2.7.7.7 ; Antibiotic resistance Cytoplasm replication DNA-directed Exonuclease Hydrolase Nucleotidyltransferase

Pubmed 1901559,2499883

 

prodomImg

pubmed

26

199

S=110 I=30 E=5.74972e-05

DNA polymerase III C ; Cytoplasm replication DNA-directed Exonuclease Hydrolase Nucleotidyltransferase

Pubmed 12509989

 

prodomImg

sp

1

211

S=1111 I=100 E=2.15289e-126

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

 

prodomImg

sp

1

211

S=1103 I=99 E=1.93741e-125

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

 

prodomImg

sp

1

210

S=1078 I=97 E=2.20258e-122

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

 

prodomImg

sp

1

210

S=1078 I=97 E=2.20258e-122

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

 

prodomImg

sp

11

208

S=872 I=79 E=1.73461e-97

Ribonuclease T EC=3.1.13.- ; Exonuclease Hydrolase tRNA processing

 

prodomImg

Iprscan [G3DSA:3.30.420.10]

18

211

-

Iprscan IPR013520 [PF00929]

25

200

Exonuclease, RNase T/DNA polymerase III

Iprscan IPR006055 [SM00479]

24

209

Exonuclease

Iprscan IPR005987 [TIGR01298]

16

211

Ribonuclease T

PDA1G1A2

133

211

S=308 I=71 E=7.1202e-30

PD157099

26

132

S=141 I=36 E=1.45648e-09

PDA1S6O0

1

25

S=133 I=100 E=1.2224e-08

PDA26413

123

208

S=116 I=33 E=1.2527e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nQJ5EGMo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

82 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr29430.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr29430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr29430.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr29430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rnhB XFF4834R_chr30900
XFF4834R_chr30890
XFF4834R_chr30890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30910
XFF4834R_chr30910
ID rnhB
AC XFF4834R_chr30900
LT XFF4834R_chr30900
OR XFF4834R_chr from 3554279 to 3555025 on strand +
DE probable ribonuclease HII
IP Ribonuclease HII/HIII
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Molecular Function: RNA binding (GO:0003723)
Molecular Function: ribonuclease H activity (GO:0004523)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101028)
MW 26949.5 Da
SQ 248 aa
 
........10........20........30........40........50
| | | | |
MKIIALGTQADSADAEARQSPLFDKSQIPNVESRRLIAGVDEAGRGPLAG
PVAVAAVVFDPGKPRINGLDDSKQLTAERREQLYARIVDRALAWSVVLID
SEEIDRINIYQATMLGMRRAVEGVAHVAGFARIDGNRVPKGLPCPAEALI
GGDALDRAIMAASIVAKVTRDRLMHELHARHPEYRFDQHKGYSTPVHLAA
LQTHGPCPQHRRSFAPVRLALQGREGLEPGHGTRDPEQLQVGQLVAPL
Show or not Domain decomposition
 
Hamap RNH2_MF_00052_B raw_score=4242 norm_score=36.762

Ribonuclease HII [rnhB].

X.species

NP_641742.1 lcl|rnhB-XAC1407

17

248

S=974 I=85 E=4.45885e-111

ribonuclease HII

X.species

NP_636733.1 lcl|rnhB-XCC1359

17

221

S=839 I=82 E=8.60955e-95

ribonuclease HII

X.species

lcl|rnhB-XALc_2039

18

235

S=712 I=70 E=2.59545e-79

probable ribonuclease hII (rnase hII, degrades rna of dna-rna hybrids) protein

X.species

YP_363195.1 lcl|rnhB-XCV1464

117

248

S=633 I=93 E=8.43167e-70

ribonuclease HII

pubmed

35

222

S=400 I=46 E=5.14894e-40

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 8917090

 

prodomImg

pubmed

35

221

S=376 I=47 E=4.91697e-37

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 3316192

 

prodomImg

pubmed

36

221

S=375 I=44 E=6.72995e-37

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 8917113

 

prodomImg

pubmed

36

221

S=370 I=47 E=2.40349e-36

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 2676978

 

prodomImg

pubmed

69

217

S=355 I=43 E=1.43454e-34

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 15637156

 

prodomImg

pubmed

68

218

S=355 I=48 E=1.66373e-34

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 10086841

 

prodomImg

pubmed

67

218

S=352 I=49 E=4.04862e-34

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 7896686

 

prodomImg

pubmed

69

217

S=348 I=50 E=1.02018e-33

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 7499342

 

prodomImg

pubmed

36

219

S=345 I=40 E=2.92984e-33

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

Pubmed 18550617

 

prodomImg

pubmed

30

217

S=339 I=44 E=1.44469e-32

Ribonuclease EC=3.1.26.- ; Endonuclease Hydrolase

Pubmed 15003709

 

prodomImg

sp

1

248

S=1014 I=81 E=1.37417e-114

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

 

prodomImg

sp

1

248

S=1013 I=81 E=1.98187e-114

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

 

prodomImg

sp

17

248

S=974 I=85 E=1.1296e-109

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

 

prodomImg

sp

17

221

S=839 I=82 E=2.18114e-93

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

 

prodomImg

sp

17

221

S=839 I=82 E=2.18114e-93

Ribonuclease HII EC=3.1.26.4 ; Cytoplasm Endonuclease Hydrolase Manganese Metal-binding

 

prodomImg

Iprscan [G3DSA:3.30.420.10]

36

179

-

Iprscan IPR001352 [PF01351]

38

217

Ribonuclease HII/HIII

Iprscan [seg]

43

62

-

PD005501

133

214

S=210 I=53 E=4.98299e-18

PDA7T6B3

215

248

S=142 I=91 E=9.11264e-10

PDA1V2I1

100

132

S=131 I=79 E=2.25464e-08

PDA7T699

215

248

S=114 I=76 E=2.13616e-06

PDA1F7A7

90

135

S=113 I=50 E=3.33231e-06

PDA7O451

1

36

S=111 I=64 E=5.24377e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rGRMRQJM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

41 hits
swiss-prot

Swiss-Prot ncbi-blastp

593 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr30900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr30900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr30900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnhP8x4/XFF4834R_chr30900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr33910785_3598132_r3_XFF4834R-XFF4834R_chr31290 XFF4834R_chr31290
XFF4834R_chr31280
XFF4834R_chr31280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31300
XFF4834R_chr31300
ID XFF4834R_chr33910785_3598132_r3_XFF4834R-XFF4834R_chr31290
AC XFF4834R_chr31290
LT XFF4834R_chr31290
OR XFF4834R_chr from 3597785 to 3598132 on strand -
DE putative endoribonuclease L-PSP
IP Endoribonuclease L-PSP; YjgF-like protein, conserved site
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro


Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100421)
MW 12616.3 Da
SQ 115 aa
 
........10........20........30........40........50
| | | | |
MLQRFDAGPRMSEMTVHAGVCYLAGQIAEDTSQDITGQTRQVLGEIDKLL
ALAASDKTKILRAEIFLADIADFDGMNKAWDEWVPHGFTPARATVEARLA
RPEWKVEIVVTAATG
X.species

YP_363158.1 lcl|XCV1427

1

115

S=588 I=97 E=6.60729e-65

putative endoribonuclease L-PSP

X.species

NP_641706.1 lcl|XAC1371-XAC1371

1

115

S=588 I=97 E=6.60729e-65

hypothetical protein

X.species

NP_636699.1 lcl|XCC1325

1

115

S=569 I=92 E=1.22501e-62

hypothetical protein

X.species

lcl|XALc_2502

1

113

S=436 I=71 E=1.93557e-46

putative endoribonuclease l-psp protein

pubmed

2

113

S=328 I=58 E=5.82035e-32

Putative translational inhibitor

Pubmed 16935252

 

prodomImg

pubmed

17

113

S=197 I=41 E=4.86634e-16

Hyp116

Pubmed 11157233,11157232

 

prodomImg

pubmed

6

98

S=140 I=37 E=3.3254e-09

Protein mmf1, mitochondrial ; Cytoplasm Mitochondrion Transit peptide

Pubmed 12185840

 

prodomImg

pubmed

8

112

S=121 I=33 E=6.90535e-07

YjgF family regulator

Pubmed 17317567,14982786

 

prodomImg

pubmed

2

108

S=121 I=26 E=7.66697e-07

Plastid-lipid associated protein

Pubmed 16845531

 

prodomImg

pubmed

22

115

S=118 I=30 E=1.4873e-06

Ribonuclease UK114 EC=3.1.-.- ; Cytoplasm Endonuclease Hydrolase Nucleus Phosphoprotein

Pubmed 8973653

 

prodomImg

pubmed

22

115

S=118 I=31 E=1.637e-06

Ribonuclease UK114 EC=3.1.-.- ; Acetylation Endonuclease Hydrolase Phosphoprotein

Pubmed 8814279,9767104

 

prodomImg

pubmed

15

95

S=111 I=31 E=1.03941e-05

Putative ferredoxin ; Plasmid

Pubmed 10633088

 

prodomImg

pubmed

34

112

S=110 I=35 E=1.36198e-05

2-aminomuconate deaminase

Pubmed 9791097,12823813

 

prodomImg

pubmed

15

95

S=110 I=31 E=1.52544e-05

YjgF-like protein

Pubmed 10550475

 

prodomImg

sp

1

115

S=335 I=52 E=6.28393e-33

UPF0076 protein HD_0322

 

prodomImg

sp

2

112

S=312 I=54 E=3.7803e-30

UPF0076 protein HI1627

 

prodomImg

sp

4

113

S=234 I=45 E=8.89459e-21

UPF0076 protein yoaB

 

prodomImg

sp

4

113

S=234 I=45 E=8.89459e-21

UPF0076 protein yoaB

 

prodomImg

sp

4

113

S=234 I=45 E=8.89459e-21

UPF0076 protein yoaB

 

prodomImg

PD779675

27

113

S=146 I=37 E=3.42765e-10

PD002429

8

108

S=130 I=35 E=2.68071e-08

PDA19922

11

49

S=102 I=46 E=6.797e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL