Xanthomonas fuscans subsp. fuscans

10 hits

  1. XFF4834R_chr09710rpoBXFF4834R_chr09710DNA-directed RNA polymerase subunit beta
  2. XFF4834R_chr09720rpoCXFF4834R_chr09720RNA polymerase, beta prime subunit
  3. XFF4834R_chr10020rpoAXFF4834R_chr10020DNA-directed RNA polymerase subunit alpha
  4. XFF4834R_chr12500rpoZXFF4834R_chr12500DNA-directed RNA polymerase subunit omega
  5. XFF4834R_chr16660hpfXFF4834R_chr16660probable sigma-54 modulation protein
  6. XFF4834R_chr21580XFF4834R_chr23500246_2502606_f1_XFF4834R-XFF4834R_chr21580XFF4834R_chr21580putative Tex-like transcriptional accessory protein
  7. XFF4834R_chr27310greBXFF4834R_chr27310transcription elongation factor
  8. XFF4834R_chr31340XFF4834R_chr31340putative 2'-5' RNA ligase
  9. XFF4834R_chr31580XFF4834R_chr34150806_3627828_f1_XFF4834R-XFF4834R_chr31580XFF4834R_chr31580putative mRNA 3'-end processing factor
  10. XFF4834R_chr37230rhoXFF4834R_chr37230transcription termination factor

rpoB XFF4834R_chr09710
XFF4834R_chr09700
XFF4834R_chr09700
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09720
XFF4834R_chr09720
ID rpoB
AC XFF4834R_chr09710
LT XFF4834R_chr09710
OR XFF4834R_chr from 1106593 to 1110744 on strand +
DE DNA-directed RNA polymerase subunit beta
IP DNA-directed RNA polymerase, beta subunit, bacterial-type
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
Biological Process: transcription (GO:0006350)
DNA-dependent (GO:0006351)
Molecular Function: DNA-directed RNA polymerase activity (GO:0003899)
Molecular Function: ribonucleoside binding (GO:0032549)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 154225 Da
SQ 1383 aa
 
........10........20........30........40........50
| | | | |
MTSYSFTEKKRIRKDFGKQRSILEVPFLLAIQVDSYREFLQEDVEPNKRK
DLGLHAALKSVFPISSYSGNAALEYVGYKLGQPVFDERECRQRGMSYGAP
LRVTVRLVIYDRESSTKAIKYVKEQEVYLGEIPLMTGNGTFIVNGTERVI
VSQLHRSPGVFFDHDRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDALF
TRIDRRRKLPVSILLRALGYSNEEMLAEFFEINTFHINPDEGVQLELVPE
RLRGETLNFDLADGDKVIVEAGKRITARHVKQLEAAGVAALAVPDDYLVG
RILSHDVVDGSTGELLANANDEINEDQLAAFRKAGVDAVGTLWVNDLDRG
PYLSNTLRIDPTKTQLEALVEIYRMMRPGEPPTKEAAQNLFHNLFFTFER
YDLSTVGRMKFNRRVGRKDVLGESVLYDKKYFAERNDEESKRLVAEHADT
SDILEVIKVLTEIRNGRGVVDDIDHLGNRRVRSVGEMAENVFRVGLVRVE
RAVKERLSMAESEGLTPQELINAKPVAAAIKEFFGSSQLSRFMDQNNPLS
EVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCTIETPEGPNIGLI
NSLAVFARTNQYGFLETPYRKVLDGKVSDDVEYLSAIEENEYVIAQANAL
TDAKNMLTEQFVPCRFQGESLLKPPSEVHFMDVSPMQTVSVAAALVPFLE
HDDANRALMGANMQRQAVPTLRSQKPLVGTGIERAVARDSGVTVNALRGG
VIEQIDAARIVVKVNEAEIGGGTDAGVDIYNLIKYTRSNQNTCINQRPLV
NVGDVIARGDVLADGPSTDIGELALGQNMLIAFMPWNGYNFEDSILLSER
VVEEDRYTTIHIEELTCVARDTKLGPEEISADIPNVSEQALNRLDESGVV
YIGAEVRAGDIMVGKVTPKGESQLTPEEKLLRAIFGEKASDVKDSSLRVP
PGMDGTVIDVQVFTRDGIEKDKRARQIEESEIKRVKKDFDDQFRILEAAI
YARLRSQIVGKVANGGANLKKGDTVTDAYLDGLKKSDWFQLRMKDEDAAD
AIERAQKQIQAHEKEFEARFADKRGKITQGDDLAPGVLKMVKVFLAVKRR
IQPGDKMAGRHGNKGVVSNVVPVEDMPYMATGESVDIVLNPLGVPSRMNI
GQILEVHLGWAAKGLGRKIQRMLEAQAAVSELRKFLNDIYNHDNAINAQR
VDLSQFSDEELLNLGKNLIDGVPMATPVFDGASEAEIKRMLELADLPQSG
QTQLYDGRTGEAFDRKTTVGYMHYLKLNHLVDDKMHARSTGPYSLVTQQP
LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVQGRNQMYKNI
VDGEHEMVAGMPESFNVLVKEIRSLAINMELEE
Show or not Domain decomposition
 
XFF4834R

NP_641312.1 lcl|rpoB-XAC0965

1

1383

S=7345 I=100 E=0

DNA-directed RNA polymerase subunit beta

XFF4834R

YP_362722.1 lcl|rpoB-XCV0991

1

1383

S=7332 I=100 E=0

DNA-directed RNA polymerase subunit beta

XFF4834R

NP_636274.1 lcl|rpoB-XCC0888

1

1383

S=7253 I=99 E=0

DNA-directed RNA polymerase subunit beta

XFF4834R

lcl|rpoB-XALc_0507

1

1383

S=6943 I=94 E=0

probable dna-directed rna polymerase, beta subunit protein

Iprscan [coil]

968

989

-

Iprscan [coil]

1045

1066

-

Iprscan [G3DSA:3.90.1100.10]

11

742

-

Iprscan [G3DSA:2.40.50.100]

743

815

-

Iprscan [G3DSA:2.40.270.10]

818

1292

-

Iprscan IPR010243 [MF_01321]

14

1383

DNA-directed RNA polymerase, beta subunit, bacterial-type

Iprscan [PTHR20856:SF3]

517

1381

-

Iprscan IPR015712 [PTHR20856]

517

1381

DNA-directed RNA polymerase, subunit 2

Iprscan IPR007120 [PF00562]

691

1306

DNA-directed RNA polymerase, subunit 2, domain 6

Iprscan IPR007641 [PF04560]

1308

1382

RNA polymerase Rpb2, domain 7

Iprscan IPR007645 [PF04565]

541

610

RNA polymerase Rpb2, domain 3

Iprscan IPR007644 [PF04563]

28

537

RNA polymerase, beta subunit, protrusion

Iprscan IPR007642 [PF04561]

157

227

RNA polymerase Rpb2, domain 2

Iprscan IPR007642 [PF04561]

362

418

RNA polymerase Rpb2, domain 2

Iprscan IPR007642 [PF04561]

449

482

RNA polymerase Rpb2, domain 2

Iprscan IPR019462 [PF10385]

619

684

DNA-directed RNA polymerase, beta subunit, external 1 domain

Iprscan IPR010243 [TIGR02013]

9

1381

DNA-directed RNA polymerase, beta subunit, bacterial-type

Iprscan IPR007121 [PS01166]

1104

1116

RNA polymerase, beta subunit, conserved site

Iprscan [SSF64484]

3

1382

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7i0QKN7V)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

19 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rpoC XFF4834R_chr09720
XFF4834R_chr09710
XFF4834R_chr09710
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09730
XFF4834R_chr09730
ID rpoC
AC XFF4834R_chr09720
LT XFF4834R_chr09720
OR XFF4834R_chr from 1110895 to 1115109 on strand +
DE RNA polymerase, beta prime subunit
IP DNA-directed RNA polymerase, subunit beta-prime; DNA-directed RNA pol I, largest subunit
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
Biological Process: transcription (GO:0006350)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: DNA-directed RNA polymerase activity (GO:0003899)

Curated
PM
AN
CC COG: [KS] Transcription;Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 155134.6 Da
SQ 1404 aa
 
........10........20........30........40........50
| | | | |
MKDLLNLFNQQRQTLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFK
PERDGLFCAAIFGPIKDYECLCGKYKRMKHRGVVCEKCGTEVTLAKVRRE
RMGHIDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFEAYVVTEPG
LTPLERRQLLTEEQYLTARQEYNDDFDAAMGAEAVYELLRTIDLQSEMTR
LREEIASTGSETKLKRLTKRIKLIEAFLESGNRPEWMVMTVLPVLPPDLR
PLVPLDGGRFATSDLNDLYRRVINRNNRLRRLLELNAPDIIVRNEKRMLQ
ESVDALLDNGRRGRAITGTNKRPLKSLADMIKGKQGRFRQNLLGKRVDYS
GRSVITVGPYLKLHQCGLPKKMALELFKPFVFAKLQRRGLATTIKAAKKL
VEREEAEVWDILEEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
PLVCTAFNADFDGDQMAVHVPLSLEAQLEARALMMSTNNILSPANGEPII
VPSQDVVLGLYYMSRALENKKGEGMVFANTSEVKRAYDNRVVELHAKVKV
RITQVDVEAGGKRSSGTSIVDTTVGRALLSEILPEGLPFQLANTEMTKKN
ISRLINSSYRLLGLKDTVVFADKLMYTGYAYATRAGVSIGIDDMLIPDEK
KGILTEAEAEVLEIQEQYQSGLVTAGERYNKVVDIWSRTSERIAKAMMDT
IGTEKVENAKGETIDQKSMNSLYIMADSGARGSQAQIRQLAGMRGLMARP
DGSIIETPIKANFREGLNVQEYFNSTHGARKGLADTALKTANSGYLTRRL
VDVAQDVVITEIDCGTTEGLIMTPIVEGGDVVEPLRERVLGRVVAEDVYL
PGNDEEPIVTRNTLLDEAWVAKLEDASVQSVKVRSTISCESSFGVCARCY
GRDLARGHQVNIGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAVDN
ITVKTTGSVKFNNLKSVAHASGSLVAVSRSGELSVLDGHGRERERYKLPY
GATITAKDGDAVKAGQSVANWDPHNHPIVSEVAGFIRFIDFVDGVTVIEK
TDELTGLASREITDPKRRGAQAKELRPIVRIVDAKGNDLTIPNTDLPAQY
LLPPRSIVNLQDGAAVGVGDVVAKIPQEASKTRDITGGLPRVADLFEARK
PKDPAILAERSGIISFGKDTKGKQRLIIKDTDGSEHEELIPKYRQIIVFE
GEHVTKGETVVDGEPSPQDILRLLGVEPLAAYLVKEIQDVYRLQGVKIND
KHIEVITRQMLRKVEIVDQGNSKFLNGEQVERQRVIEENARLVKRNELPA
KYDPVLLGITKASLATESFISAASFQETTRVLTEAAVRGTRDNLRGLKEN
VIVGRLIPAGTGLAYHAGRRKASGLTDSEMETLSGKPAVAEPVAAVADAG
ADEE
Show or not Domain decomposition
 
XFF4834R

YP_362723.1 lcl|rpoC-XCV0992

1

1386

S=6995 I=96 E=0

DNA-directed RNA polymerase subunit beta'

XFF4834R

NP_641313.1 lcl|rpoC-XAC0966

1

1386

S=6995 I=96 E=0

DNA-directed RNA polymerase subunit beta'

XFF4834R

NP_636275.1 lcl|rpoC-XCC0889

1

1386

S=6940 I=95 E=0

DNA-directed RNA polymerase subunit beta'

XFF4834R

lcl|rpoC-XALc_0508

1

1385

S=6604 I=90 E=0

probable dna-directed rna polymerase, subunit beta-prime protein

Iprscan IPR007080 [G3DSA:3.90.1120.10]

16

345

RNA polymerase Rpb1, domain 1

Iprscan IPR000722 [G3DSA:2.40.40.30]

346

488

RNA polymerase, alpha subunit

Iprscan [PTHR19376:SF4]

14

1363

-

Iprscan [PTHR19376]

14

1363

-

Iprscan IPR007081 [PF04998]

766

1321

RNA polymerase Rpb1, domain 5

Iprscan IPR000722 [PF00623]

344

486

RNA polymerase, alpha subunit

Iprscan IPR007080 [PF04997]

16

342

RNA polymerase Rpb1, domain 1

Iprscan IPR007083 [PF05000]

674

763

RNA polymerase Rpb1, domain 4

Iprscan IPR007066 [PF04983]

489

644

RNA polymerase Rpb1, domain 3

Iprscan IPR006592 [SM00663]

235

514

RNA polymerase, N-terminal

Iprscan IPR012754 [TIGR02386]

19

1368

DNA-directed RNA polymerase, subunit beta-prime

Iprscan [SSF64484]

5

1363

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PmHek0ow)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr09720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rpoA XFF4834R_chr10020
XFF4834R_chr10010
XFF4834R_chr10010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10030
XFF4834R_chr10030
ID rpoA
AC XFF4834R_chr10020
LT XFF4834R_chr10020
OR XFF4834R_chr from 1132809 to 1133807 on strand +
DE DNA-directed RNA polymerase subunit alpha
IP DNA-directed RNA polymerase, dimerisation; DNA-directed RNA polymerase, alpha subunit
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
Biological Process: transcription (GO:0006350)
DNA-dependent (GO:0006351)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: DNA-directed RNA polymerase activity (GO:0003899)
Molecular Function: protein dimerization activity (GO:0046983)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 36363.1 Da
SQ 332 aa
 
........10........20........30........40........50
| | | | |
MTVTANQVLRPRGPQIERLTDNRAKVVIEPLERGYGHTLGNALRRVLLSS
IPGFAITEVEIDGVLHEYTTVEGLQEDVLDVLLNLKDVAIRMHSGDSATL
SLSKQGPGTVTAADIRTDHNVEIINGDHVICHLTKDTALNMRLKIERGFG
YQPAAARRRPDEETRTIGRLMLDASFSPVRRVAYAVEAARVEQRTDLDKL
VIDIETNGTIDAEEAVRTAADILSDQLSVFGDFTHRDRGAAKPAASGVDP
VLLRPIDDLELTVRSANCLKAESIYYIGDLIQKTEVELLKTPNLGKKSLT
EIKEVLAQRGLALGMKLENWPPAGVAQHGMLG
Show or not Domain decomposition
 
XFF4834R

YP_362754.1 lcl|rpoA-XCV1023

1

332

S=1569 I=92 E=0

DNA-directed RNA polymerase subunit alpha

XFF4834R

NP_636305.1 lcl|rpoA-XCC0919

1

332

S=1569 I=92 E=0

DNA-directed RNA polymerase subunit alpha

XFF4834R

NP_641343.1 lcl|rpoA-XAC0996

1

332

S=1569 I=92 E=0

DNA-directed RNA polymerase subunit alpha

XFF4834R

lcl|rpoA-XALc_0538

1

332

S=1526 I=88 E=9.27855e-178

probable dna-directed rna polymerase alpha chain (rna polymerase alpha subunit) protein

Iprscan IPR011262 [G3DSA:2.170.120.12]

53

176

DNA-directed RNA polymerase, insert

Iprscan [G3DSA:1.10.150.20]

245

328

-

Iprscan IPR011773 [MF_00059]

5

316

DNA-directed RNA polymerase, alpha subunit

Iprscan IPR011261 [PF01193]

28

230

DNA-directed RNA polymerase, dimerisation

Iprscan IPR011260 [PF03118]

250

307

RNA polymerase, alpha subunit, C-terminal

Iprscan IPR011262 [PF01000]

60

154

DNA-directed RNA polymerase, insert

Iprscan IPR011263 [SM00662]

23

233

DNA-directed RNA polymerase, RpoA/D/Rpb3-type

Iprscan IPR011773 [TIGR02027]

23

316

DNA-directed RNA polymerase, alpha subunit

Iprscan [seg]

77

88

-

Iprscan [seg]

179

194

-

Iprscan IPR011262 [SSF56553]

53

177

DNA-directed RNA polymerase, insert

Iprscan IPR009025 [SSF55257]

2

230

DNA-directed RNA polymerase, RBP11-like

Iprscan IPR011260 [SSF47789]

248

328

RNA polymerase, alpha subunit, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hroKjvNb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

426 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr10020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr10020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr10020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr10020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rpoZ XFF4834R_chr12500
XFF4834R_chr12490
XFF4834R_chr12490
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1339
XFF4834R_chr_1339
ID rpoZ
AC XFF4834R_chr12500
LT XFF4834R_chr12500
OR XFF4834R_chr from 1414611 to 1414910 on strand +
DE DNA-directed RNA polymerase subunit omega
IP RNA polymerase Rpb6
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
DNA-dependent (GO:0006351)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: DNA-directed RNA polymerase activity (GO:0003899)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 11142.4 Da
SQ 99 aa
 
........10........20........30........40........50
| | | | |
MARITVEDCLEVVNNRFELVMMASKRARQLANGVQPLIENADASDKPTVM
ALREIAARRIDNALIDEVEKAERERAEREALEWAAAEVVADEDMSKNDD
Show or not Domain decomposition
 
XFF4834R

YP_365242.1 lcl|rpoZ-XCV3511

1

99

S=328 I=72 E=1.684e-33

DNA-directed RNA polymerase subunit omega

XFF4834R

NP_638594.1 lcl|rpoZ-XCC3248

1

99

S=328 I=72 E=1.684e-33

DNA-directed RNA polymerase subunit omega

XFF4834R

NP_643701.1 lcl|rpoZ-XAC3394

1

99

S=328 I=72 E=1.684e-33

DNA-directed RNA polymerase subunit omega

XFF4834R

lcl|rpoZ-XALc_0798

1

99

S=297 I=64 E=9.77524e-30

probable dna-directed rna polymerase omega subunit protein

Iprscan IPR003716 [MF_00366]

1

63

DNA-directed RNA polymerase, omega subunit

Iprscan IPR006110 [PF01192]

7

61

RNA polymerase Rpb6

Iprscan IPR003716 [TIGR00690]

1

67

DNA-directed RNA polymerase, omega subunit

Iprscan [seg]

66

93

-

Iprscan IPR006110 [SSF63562]

1

85

RNA polymerase Rpb6

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TQYMadds)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

350 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr12500.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr12500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr12500.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr12500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
hpf XFF4834R_chr16660
XFF4834R_chr16650
XFF4834R_chr16650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16670
XFF4834R_chr16670
ID hpf
AC XFF4834R_chr16660
LT XFF4834R_chr16660
OR XFF4834R_chr from 1920154 to 1920471 on strand -
DE probable sigma-54 modulation protein
IP Ribosomal protein S30Ae/sigma 54 modulation protein
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
Biological Process: primary metabolic process (GO:0044238)
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100810)
MW 12107.8 Da
SQ 105 aa
 
........10........20........30........40........50
| | | | |
MRIETYGHQLEVTPALREYVASKLQRLQRHFDQHCEVRTQLAVRKPDHHV
VATVNLPGRTLHADASGSTMYAAIDLLVDKLDRLILKHKEKKCNHHAREV
RDNPA
XFF4834R

NP_643282.1 lcl|XAC2973-XAC2973

1

105

S=549 I=99 E=2.68132e-60

sigma-54 modulation protein

XFF4834R

NP_638151.1 lcl|XCC2803

1

105

S=546 I=98 E=7.83591e-60

sigma-54 modulation protein

XFF4834R

YP_364850.1 lcl|XCV3119

1

89

S=451 I=97 E=2.06153e-48

sigma-54 modulation protein

XFF4834R

lcl|XALc_2141

1

105

S=442 I=79 E=2.51719e-47

putative sigma-54 modulation protein

pubmed

1

91

S=228 I=50 E=7.01152e-20

(rpoN)

Pubmed 8113171

 

prodomImg

pubmed

1

94

S=223 I=48 E=2.63852e-19

Probable sigma(54) modulation protein

Pubmed 2695747,3481423

 

prodomImg

pubmed

1

92

S=219 I=50 E=8.86513e-19

Putative sigma-54 modulation protein

Pubmed 11697147

 

prodomImg

pubmed

1

92

S=218 I=50 E=1.23473e-18

Putative sigma-54 modulation protein

Pubmed 15782640

 

prodomImg

pubmed

1

95

S=217 I=48 E=1.46995e-18

Putative uncharacterized protein

Pubmed 9687481

 

prodomImg

sp_Pdown

sp|P17160|RP5M_AZOVI

1

94

S=223 I=48 E=1.66185e-19

Probable sigma(54) modulation protein

sp_Pdown

sp|P0AFX3|RP5M_SHIFL

1

95

S=199 I=43 E=1.36836e-16

Probable sigma(54) modulation protein

sp_Pdown

sp|P0AFX0|RP5M_ECOLI

1

95

S=199 I=43 E=1.36836e-16

Probable sigma(54) modulation protein

sp_Pdown

sp|P0AFX1|RP5M_ECOL6

1

95

S=199 I=43 E=1.36836e-16

Probable sigma(54) modulation protein

sp_Pdown

sp|P0AFX2|RP5M_ECO57

1

95

S=199 I=43 E=1.36836e-16

Probable sigma(54) modulation protein

Iprscan IPR003489 [G3DSA:3.30.160.100]

1

98

Ribosomal protein S30Ae/sigma 54 modulation protein

Iprscan IPR003489 [PF02482]

3

95

Ribosomal protein S30Ae/sigma 54 modulation protein

Iprscan IPR003489 [TIGR00741]

1

99

Ribosomal protein S30Ae/sigma 54 modulation protein

PD696818

9

102

S=234 I=57 E=7.60867e-21

PD003440

1

80

S=137 I=39 E=3.88313e-09

PD894917

1

90

S=111 I=30 E=4.69243e-06

PD734388

1

95

S=102 I=30 E=6.41725e-05

Iprscan IPR003489 [SSF69754]

1

99

Ribosomal protein S30Ae/sigma 54 modulation protein

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UjcTBKm0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

28 hits
swiss-prot

Swiss-Prot ncbi-blastp

35 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr16660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr16660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr16660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr16660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr23500246_2502606_f1_XFF4834R-XFF4834R_chr21580 XFF4834R_chr21580
XFF4834R_chr21570
XFF4834R_chr21570
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2306
XFF4834R_chr_2306
ID XFF4834R_chr23500246_2502606_f1_XFF4834R-XFF4834R_chr21580
AC XFF4834R_chr21580
LT XFF4834R_chr21580
OR XFF4834R_chr from 2500246 to 2502606 on strand +
DE putative Tex-like transcriptional accessory protein
IP Transcription elongation factor Spt6; Tex-like protein, N-terminal
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
Molecular Function: RNA binding (GO:0003723)
acting on ester bonds (GO:0016788)
nucleotide and nucleic acid metabolic process (GO:0006139)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 84983.7 Da
SQ 786 aa
 
........10........20........30........40........50
| | | | |
MHDSQLAQQIARTIADEIGAQPAQAHAAIALLDEGASVPFIARYRKEVTG
GLDDTQLRNLETRLTYLRELEERRAAILSSIGEQGKLSDELRNEIVAADT
KSRLEDLYLPYKPKRRTRAQIAREAGLEPLADGLLADPTQSPDVAAAAFI
DAEKGVADSKAALEGARAILMERWGEDAALVGELRSWLGDNGVIRARVAE
GKEEAGAKYRDYFDHAETLAKIPSHRLLALFRARREEILYLDLDPGSDAE
AGHQYAEGRVARNAGISNEGRPADRWLLDACRLTWRAKLHMHLLLDLFNQ
AREKAEAEAIAVFGDNLKDLMLAAPAGPRVVLGLDPGIRTGCKIAVVDAT
GKLVATETIYPHEPKRQWDQSLQTIKKLCMQHNVELIAIGNGTASRETDK
LAGEAIALCGAAKLQKVVVSEAGASVYSASEFAAKEFPNLDVSLRGAVSI
ARRLQDPLAELVKIEPKAIGVGQYQHDVDQYRLAKALEARVEDCVNAVGV
YVNTASAALLSRVSGLSGTVAENIVRHRDDNGPFKRRKDLLKVPRLGDKT
FEQCAGFLRIADGDEPLDVSAVHPEAYPVVERIVGSTGKPIKALLGDGSF
LRGLKPEMFTDDQFGVPTVRDILKELEKPGRDPRPEFKAAQFAEGIEDIK
HLKPGMVLEGVVSNVAAFGAFVDIGVHQDGLVHISALSETFVKDPRDVVK
AGDIVKVKVLEVDVARKRIALTCRLSDTPPAADGSAQPRDARGSGPGQGR
RDGGGRGQAQANSKPRITAPPADNALAAAFARAKRS
XFF4834R

XFF4834R_chr26790 lcl|pnp-XFF4834R_chr26790

639

737

S=153 I=43 E=1.34007e-11

polynucleotide phosphorylase/polyadenylase

XFF4834R

XFF4834R_chr23010 lcl|rpsA-XFF4834R_chr23010

652

729

S=150 I=42 E=3.34743e-11

30S ribosomal subunit protein S1

XFF4834R

XFF4834R_chr23010 lcl|rpsA-XFF4834R_chr23010

660

724

S=129 I=47 E=9.85173e-09

30S ribosomal subunit protein S1

XFF4834R

NP_642379.1 lcl|tex-XAC2053

1

768

S=3628 I=92 E=0

transcription-related protein

XFF4834R

YP_363945.1 lcl|tex-XCV2214

1

768

S=3588 I=91 E=0

transcription-related protein

XFF4834R

NP_637510.1 lcl|tex-XCC2154

1

740

S=3437 I=89 E=0

transcription-related protein

XFF4834R

lcl|tex-XALc_1636

1

729

S=3126 I=82 E=0

putative transcription-related protein

XFF4834R

lcl|pnp-XALc_1020

646

724

S=153 I=48 E=4.64661e-11

probable polynucleotide phosphorylase protein

XFF4834R

YP_364564.1 lcl|pnp-XCV2833

639

737

S=153 I=43 E=5.06992e-11

polynucleotide phosphorylase/polyadenylase

XFF4834R

NP_642994.1 lcl|pnp-XAC2683

639

737

S=153 I=43 E=5.20428e-11

polynucleotide phosphorylase/polyadenylase

XFF4834R

NP_637857.1 lcl|pnp-XCC2507

639

724

S=153 I=47 E=5.38898e-11

polynucleotide phosphorylase/polyadenylase

XFF4834R

YP_364227.1 lcl|rpsA-XCV2496

652

729

S=150 I=42 E=1.17086e-10

30S ribosomal protein S1

XFF4834R

YP_364227.1 lcl|rpsA-XCV2496

660

724

S=129 I=47 E=3.56823e-08

30S ribosomal protein S1

pubmed

6

736

S=2159 I=59 E=0

HI0568-like protein

Pubmed 16714566

 

prodomImg

pubmed

9

727

S=2124 I=60 E=0

Protein tex ; RNA-binding

Pubmed 8755871

 

prodomImg

pubmed

9

732

S=2057 I=58 E=0

Uncharacterized protein NMB0075 ; RNA-binding

Pubmed 8655518

 

prodomImg

pubmed

9

491

S=1200 I=53 E=2.71774e-136

Uncharacterized protein in region E ; RNA-binding

Pubmed 8655518

 

prodomImg

pubmed

436

729

S=1153 I=72 E=1.3462e-130

Putative uncharacterized protein

Pubmed 14660376

 

prodomImg

pubmed

509

732

S=780 I=67 E=2.00501e-85

Tex protein

Pubmed 9321671

 

prodomImg

pubmed

420

723

S=735 I=53 E=5.58612e-80

YdcI

Pubmed 10972189

 

prodomImg

pubmed

359

588

S=613 I=56 E=3.44507e-65

YdcI protein

Pubmed 9341680

 

prodomImg

pubmed

10

401

S=519 I=32 E=9.63393e-54

YdcI protein

Pubmed 9341680

 

prodomImg

pubmed

296

500

S=574 I=57 E=1.70791e-60

Putative uncharacterized protein

Pubmed 11958930

 

prodomImg

Iprscan IPR012340 [G3DSA:2.40.50.140]

655

750

Nucleic acid-binding, OB-fold

Iprscan IPR018974 [PF09371]

14

206

Tex-like protein, N-terminal

Iprscan IPR003029 [PF00575]

651

724

Ribosomal protein S1, RNA binding domain

Iprscan IPR006641 [SM00732]

329

428

Resolvase, RNase H-like fold

Iprscan [SM00316]

653

724

-

Iprscan IPR003029 [PS50126]

655

724

Ribosomal protein S1, RNA binding domain

Iprscan [seg]

20

30

-

Iprscan [seg]

57

74

-

Iprscan [seg]

226

239

-

Iprscan [seg]

742

757

-

Iprscan [seg]

769

783

-

PD361497

372

499

S=463 I=72 E=2.02537e-48

PD491134

77

201

S=399 I=69 E=1.39498e-40

PD584958

297

371

S=266 I=65 E=1.46309e-24

PDA9Q2O1

298

583

S=220 I=24 E=6.19467e-19

PD610291

607

655

S=184 I=71 E=1.2842e-14

PD731224

417

577

S=174 I=33 E=2.30127e-13

PD011817

500

553

S=174 I=59 E=2.38294e-13

PD301170

566

721

S=172 I=36 E=3.74983e-13

PDA1U7Z9

584

614

S=154 I=94 E=6.20731e-11

PD594032

656

731

S=149 I=48 E=2.19759e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pBkx9Gwd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

99 hits
swiss-prot

Swiss-Prot ncbi-blastp

537 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr21580.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr21580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr21580.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr21580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
greB XFF4834R_chr27310
XFF4834R_chr27300
XFF4834R_chr27300
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27320
XFF4834R_chr27320
ID greB
AC XFF4834R_chr27310
LT XFF4834R_chr27310
OR XFF4834R_chr from 3148594 to 3149100 on strand +
DE transcription elongation factor
IP Transcription elongation factor GreB, prokaryotic
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription elongation regulator activity (GO:0003711)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 18829 Da
SQ 168 aa
 
........10........20........30........40........50
| | | | |
MSRWRPPAEKSTALITPEGHARLKAELDDLWRVRRPEVVRALAAAAAEGD
RSENAEYTYRKKQLGEIDRRVRYLSKRLEALRVVDTAPTDANAVFFGAQV
ELEDADSGELLRYRIVGPDETDAGRGWISIDSPLARALLKKRVDDEFDAH
LPAGKHTFVVVSVDYASL
Hamap GREA_MF_00105 raw_score=3168 norm_score=24.332

Transcription elongation factor greA [greA].

XFF4834R

XFF4834R_chr20090 lcl|greA-XFF4834R_chr20090

15

165

S=181 I=33 E=8.94073e-16

transcription elongation factor

XFF4834R

NP_643043.1 lcl|greB-XAC2734

1

168

S=712 I=85 E=1.41889e-79

transcription elongation factor GreB

XFF4834R

YP_364617.1 lcl|greB-XCV2886

1

168

S=703 I=84 E=1.50692e-78

transcription elongation factor GreB

XFF4834R

NP_637911.1 lcl|greB-XCC2563

1

167

S=674 I=80 E=5.70608e-75

transcription elongation factor GreB

XFF4834R

lcl|greB-XALc_0974

1

167

S=613 I=72 E=1.16971e-67

probable transcription elongation factor greb (transcript cleavage factor greb) protein

XFF4834R

lcl|greA-XALc_1340

15

165

S=188 I=34 E=4.64283e-16

probable transcription elongation factor grea (transcript cleavage factor grea) protein

XFF4834R

NP_637209.1 lcl|greA-XCC1844

15

165

S=181 I=34 E=3.13348e-15

transcription elongation factor GreA

XFF4834R

YP_363641.1 lcl|greA-XCV1910

15

165

S=181 I=33 E=3.21652e-15

transcription elongation factor GreA

XFF4834R

NP_642189.1 lcl|greA-XAC1863

15

165

S=181 I=33 E=3.21652e-15

transcription elongation factor GreA

pubmed

12

166

S=306 I=45 E=6.2424e-29

Transcription elongation factor greB ; DNA-binding regulation

Pubmed 8431948

 

prodomImg

pubmed

5

168

S=215 I=40 E=6.40484e-18

Transcription elongation factor GreB

Pubmed 17400765

 

prodomImg

pubmed

15

165

S=181 I=34 E=1.04016e-13

Transcription elongation factor greA ; Coiled DNA-binding regulation

Pubmed 10784047

 

prodomImg

pubmed

15

165

S=177 I=32 E=3.12033e-13

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 2243801

 

prodomImg

pubmed

56

166

S=167 I=33 E=5.44722e-12

Transcription elongation factor ; DNA-binding regulation

Pubmed 15287875

 

prodomImg

pubmed

56

166

S=167 I=33 E=5.49492e-12

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 11157937

 

prodomImg

pubmed

15

165

S=164 I=28 E=9.85501e-12

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 18700039

 

prodomImg

pubmed

16

163

S=161 I=26 E=2.85503e-11

Transcription elongation factor greA ; Coiled DNA-binding regulation

Pubmed 17107561

 

prodomImg

pubmed

56

166

S=158 I=33 E=5.2105e-11

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 9756877

 

prodomImg

pubmed

56

165

S=156 I=32 E=1.13208e-10

Transcription elongation factor ; DNA-binding regulation

Pubmed 17618403

 

prodomImg

sp_Pdown

sp|Q8PJ11|GREB_XANAC

1

168

S=712 I=85 E=3.28092e-78

Transcription elongation factor greB ; DNA-binding regulation

sp_Pdown

sp|Q8P7P8|GREB_XANCP

1

167

S=674 I=80 E=1.31943e-73

Transcription elongation factor greB ; DNA-binding regulation

Iprscan IPR001437 [G3DSA:1.10.287.180]

10

84

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan IPR001437 [G3DSA:3.10.50.30]

84

166

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan [MF_00105]

10

165

-

Iprscan IPR001437 [PF03449]

9

83

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan IPR001437 [PF01272]

89

165

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan IPR006358 [TIGR01461]

11

167

Transcription elongation factor GreB, prokaryotic

Iprscan IPR018151 [PS00829]

26

57

Transcription elongation factor, GreA/GreB, conserved site

Iprscan IPR018151 [PS00830]

129

145

Transcription elongation factor, GreA/GreB, conserved site

Iprscan [seg]

32

55

-

PD004918

98

154

S=161 I=54 E=4.36198e-12

PD882860

59

97

S=122 I=65 E=2.61971e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Z2UOH6kj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

25 hits
swiss-prot

Swiss-Prot ncbi-blastp

270 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr27310.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr27310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr27310.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr27310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31340
XFF4834R_chr31330
XFF4834R_chr31330
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31350
XFF4834R_chr31350
ID
AC XFF4834R_chr31340
LT XFF4834R_chr31340
OR XFF4834R_chr from 3604325 to 3604927 on strand -
DE putative 2'-5' RNA ligase
IP 2',5' RNA ligase; Phosphoesterase, HXTX
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
Biological Process: RNA metabolic process (GO:0016070)
Molecular Function: 2'-5'-RNA ligase activity (GO:0008664)

Curated
PM
AN Gene ID suppressed
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100421)
MW 22107 Da
SQ 200 aa
 
........10........20........30........40........50
| | | | |
MKQQFLYLSSAEAQLSLGLGEEKTTERLFFAVMADAPTAEHAARIADSLL
RGGHAEGKPLARERLHVTLHHLGDYAGGLPPSLVSRASQAATRVQMDAFA
VEFDRVGTFGGRRSQLPCVLRGEEQVRGLYELQGALGRQLAHVGIAGDAQ
YTPHMTLLYCNQAVPQRRCDALAWTVRDFALVRSFLGQSRYQIEGRWSLR
XFF4834R

NP_641700.1 lcl|XAC1365-XAC1365

1

200

S=1037 I=100 E=6.7273e-119

hypothetical protein

XFF4834R

YP_363152.1 lcl|XCV1421

1

200

S=1007 I=97 E=3.61034e-115

hypothetical protein

XFF4834R

NP_636693.1 lcl|XCC1319

1

200

S=856 I=87 E=6.60483e-97

hypothetical protein

pubmed

23

200

S=337 I=43 E=1.46736e-32

Csw019

Pubmed 14660379

 

prodomImg

PD602737

1

61

S=298 I=97 E=1.11473e-28

PD007497

62

157

S=105 I=32 E=3.14047e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0waqcjRm)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr31340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr31340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr31340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnS5fOX/XFF4834R_chr31340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr34150806_3627828_f1_XFF4834R-XFF4834R_chr31580 XFF4834R_chr31580
XFF4834R_chr_3339
XFF4834R_chr_3339
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31590
XFF4834R_chr31590
ID XFF4834R_chr34150806_3627828_f1_XFF4834R-XFF4834R_chr31580
AC XFF4834R_chr31580
LT XFF4834R_chr31580
OR XFF4834R_chr from 3626806 to 3627828 on strand +
DE putative mRNA 3'-end processing factor
IP
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro


Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100421)
MW 37707.9 Da
SQ 340 aa
 
........10........20........30........40........50
| | | | |
MRNGNDETSHTRGDLVVLGPEGLYCPQGDFHIDPWRPVPRAVITHGHGDH
ARSGMGEYHCTRESLSILQWRLGDQVYHTHADGEAFQLGRARVSLHPAGH
VLGSAQVRIEVDGEVWVASGDYKRQPDPTCKPFEVVPCDTFITEATFGLP
VYRWPDTSEVAADISAWRRECAERGEAAILYCYALGKAQRVLAELRAWET
QPALLHGAVAVGVEVYRQAGIPMLDTQPVSEHARGADYAGQLVIAPPSAA
GSAWIRRFRSAQQGFASGWMRIRGNRRRRNYDRGFVVSDHADWPDLLRTI
EDTGAQRVIATHGNTDALIQHLRERGVAAEAFRTDFGAEE
XFF4834R

NP_641677.1 lcl|XAC1342-XAC1342

1

340

S=1694 I=95 E=0

mRNA 3'-end processing factor

XFF4834R

YP_363126.1 lcl|XCV1395

1

340

S=1692 I=95 E=0

mRNA 3'-end processing factor

XFF4834R

NP_636665.1 lcl|XCC1291

1

340

S=1533 I=87 E=1.19103e-178

putative mRNA 3'-end processing factor

pubmed

98

204

S=127 I=32 E=9.43697e-07

Cleavage and polyadenylation specificity factor subunit 3 EC=3.1.27.- ; Endonuclease Hydrolase Isopeptide bond Metal-binding mRNA processing Nucleus

Pubmed 8929409

 

prodomImg

pubmed

98

204

S=127 I=32 E=1.07555e-06

Cleavage and polyadenylation specificity factor subunit 3 EC=3.1.27.- ; Endonuclease Hydrolase Isopeptide bond Metal-binding mRNA processin

Pubmed 14749727

 

prodomImg

pubmed

98

204

S=125 I=33 E=1.75257e-06

Cleavage and polyadenylation specificity factor 3

Pubmed 15256591

 

prodomImg

pubmed

96

204

S=122 I=29 E=4.01229e-06

Putative uncharacterized protein

Pubmed 12065505

 

prodomImg

pubmed

77

203

S=122 I=30 E=4.57288e-06

Endoribonuclease YSH1 EC=3.1.27.- ; Endonuclease Hydrolase Metal-binding mRNA processing Nucleus Phosphoprotein Zinc

Pubmed 8929409

 

prodomImg

sp_Pdown

sp|B1ZZL9|DNLI_OPITP

22

335

S=382 I=34 E=9.36996e-38

Probable DNA ligase EC=6.5.1.1 ; ATP-binding Cell cycle division damage recombination repair replication Metal-binding Nucleotide-binding

sp_Pdown

sp|Q4WRC2|YSH1_ASPFU

92

204

S=156 I=37 E=2.2293e-10

Endoribonuclease ysh1 EC=3.1.27.- ; Endonuclease Hydrolase Metal-binding mRNA processing Nucleus Zinc

sp_Pdown

sp|Q5BEP0|YSH1_EMENI

88

204

S=155 I=36 E=2.94671e-10

Endoribonuclease ysh1 EC=3.1.27.- ; Endonuclease Hydrolase Metal-binding mRNA processing Nucleus Zinc

sp_Pdown

sp|Q74ZC0|YSH1_ASHGO

43

203

S=138 I=28 E=3.78809e-08

Endoribonuclease YSH1 EC=3.1.27.- ; Endonuclease Hydrolase Metal-binding mRNA processing Nucleus Zinc

sp_Pdown

sp|Q86A79|CPSF3_DICDI

92

206

S=133 I=33 E=1.25075e-07

Cleavage and polyadenylation specificity factor subunit 3 EC=3.1.27.- ; Endonuclease Hydrolase Metal-binding mRNA processing Nucleus RNA-bi

PD481110

141

339

S=483 I=51 E=4.61395e-51

PD584078

14

76

S=222 I=62 E=2.10398e-19

PDA1H044

266

340

S=172 I=48 E=1.96952e-13

PDA1T7A7

223

265

S=168 I=74 E=7.15752e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL