Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr18710XFF4834R_chr20110215_2142517_r3_XFF4834R-XFF4834R_chr18710XFF4834R_chr18710exodeoxyribonuclease VII small subunit
  2. XFF4834R_chr24210xseAXFF4834R_chr24210exonuclease VII, large subunit
  3. XFF4834R_chr30290tatD2XFF4834R_chr30290putative deoxyribonuclease, TatD (DNase TatD)

XFF4834R_chr20110215_2142517_r3_XFF4834R-XFF4834R_chr18710 XFF4834R_chr18710
XFF4834R_chr18700
XFF4834R_chr18700
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18720
XFF4834R_chr18720
ID XFF4834R_chr20110215_2142517_r3_XFF4834R-XFF4834R_chr18710
AC XFF4834R_chr18710
LT XFF4834R_chr18710
OR XFF4834R_chr from 2142215 to 2142475 on strand -
DE exodeoxyribonuclease VII small subunit
IP Exonuclease VII, small subunit
CL 2.1.5 DNA degradation GO:0006308
EC
GO InterPro
Biological Process: DNA catabolic process (GO:0006308)
Cellular Component: exodeoxyribonuclease VII complex (GO:0009318)
Molecular Function: exodeoxyribonuclease VII activity (GO:0008855)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101103)
MW 9677.8 Da
SQ 86 aa
 
........10........20........30........40........50
| | | | |
MAKKSLNETSPVARFEQSLEELEQLVQKMEVGDLSLEQSLTAYERGIGLY
RDCQQALEQAELRVRLLTDPARPELAEAFEPPSLDG
XFF4834R

NP_643070.1 xseB-XAC2761

1

86

S=369 I=86 E=1.29422e-38

exodeoxyribonuclease VII small subunit

XFF4834R

YP_364646.1 xseB-XCV2915

1

86

S=365 I=85 E=3.65259e-38

exodeoxyribonuclease VII small subunit

XFF4834R

NP_637947.1 xseB-XCC2599

1

86

S=350 I=80 E=2.10536e-36

exodeoxyribonuclease VII small subunit

XFF4834R

XALc_2453 XseB-XALc_2453

1

81

S=250 I=62 E=3.16757e-24

putative exonuclease vII small subunit protein

sp_Pdown

sp|Q8PIY4|EX7S_XANAC

1

86

S=369 I=86 E=4.22485e-37

Exodeoxyribonuclease 7 small subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|Q5GXL9|EX7S_XANOR

1

86

S=365 I=85 E=1.04618e-36

Exodeoxyribonuclease 7 small subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|B2SWE7|EX7S_XANOP

1

86

S=365 I=85 E=1.04618e-36

Exodeoxyribonuclease 7 small subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|Q2P0Q1|EX7S_XANOM

1

86

S=365 I=85 E=1.04618e-36

Exodeoxyribonuclease 7 small subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|Q3BRG7|EX7S_XANC5

1

86

S=365 I=85 E=1.19235e-36

Exodeoxyribonuclease 7 small subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

Iprscan IPR003761 [PD028235]

28

56

Exonuclease VII, small subunit

Iprscan IPR003761 [PIRSF006488]

1

85

Exonuclease VII, small subunit

Iprscan IPR003761 [PF02609]

15

67

Exonuclease VII, small subunit

Iprscan IPR003761 [TIGR01280]

10

79

Exonuclease VII, small subunit

PD616614

57

86

S=137 I=93 E=3.72249e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one GQmbTkQh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

74 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr18710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr18710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr18710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr18710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
xseA XFF4834R_chr24210
XFF4834R_chr24200
XFF4834R_chr24200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2572
XFF4834R_chr_2572
ID xseA
AC XFF4834R_chr24210
LT XFF4834R_chr24210
OR XFF4834R_chr from 2791306 to 2792643 on strand +
DE exonuclease VII, large subunit
IP Exonuclease VII, large subunit
CL 2.1.5 DNA degradation GO:0006308
EC
GO InterPro
Biological Process: DNA catabolic process (GO:0006308)
Cellular Component: exodeoxyribonuclease VII complex (GO:0009318)
Molecular Function: exodeoxyribonuclease VII activity (GO:0008855)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 49396.9 Da
SQ 445 aa
 
........10........20........30........40........50
| | | | |
MADRNEQILTPSQLNSLARDLLEGSFPLVWVEAELSSVTRPSSGHLYFTL
KDARAQIRCAMFKPKSTWLKFQPREGLRVLARGRLTLYEARGDYQLVLDH
LEEAGEGALRRAFDELRARLAAEGLFDAERKQALPAHVQRLAVITSPSGA
AVRDVLSVLARRFPLLEVDLLPSLVQGDSAAAQITSLLQRADASGRYDVI
LITRGGGSLEDLWAFNDERLARAIAAAQTPVVSAVGHETDFSLSDFVADV
RAPTPSVAAELLVPDQRELVARVRRAQARMTQLQQHALGNAMQRADRLAL
RLRVQSPQARLQLFHRRQEDAGRQLRARMMHVLERLQARVQRGQAQLQSH
NPQRHLAGLQQRLRALHPQAAMQRRLQHDQLQLRSIARSLEAVSPLATVA
RGYAIVIRPADGSVVRNAAEVVTGERLRAQLADGSIEVRVESGES
XFF4834R

NP_642726.1 xseA-XAC2410

1

445

S=2132 I=95 E=0

exodeoxyribonuclease VII large subunit

XFF4834R

YP_364338.1 xseA-XCV2607

1

445

S=2122 I=94 E=0

exodeoxyribonuclease VII large subunit

XFF4834R

NP_637658.1 xseA-XCC2303

1

445

S=1935 I=86 E=0

exodeoxyribonuclease VII large subunit

XFF4834R

XALc_1090 xseA-XALc_1090

1

442

S=1386 I=66 E=1.11377e-160

probable exodeoxyribonuclease vII large subunit protein

pubmed

8

442

S=882 I=44 E=5.97807e-98

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

Pubmed 3021756

 

prodomImg

pubmed

29

444

S=748 I=39 E=9.04267e-82

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

Pubmed 15168170

 

prodomImg

pubmed

29

445

S=738 I=39 E=1.37305e-80

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

Pubmed 15168170

 

prodomImg

pubmed

7

308

S=700 I=43 E=6.13076e-76

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

Pubmed 19145256

 

prodomImg

pubmed

9

270

S=647 I=46 E=1.40878e-69

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

Pubmed 19197347

 

prodomImg

sp_Pdown

sp|Q8PJW7|EX7L_XANAC

1

445

S=2132 I=95 E=0

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|Q3BSC5|EX7L_XANC5

1

445

S=2122 I=94 E=0

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|Q5GZ80|EX7L_XANOR

1

444

S=2076 I=93 E=0

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|Q2P290|EX7L_XANOM

1

444

S=2070 I=93 E=0

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

sp_Pdown

sp|B2SHP3|EX7L_XANOP

1

444

S=2069 I=93 E=0

Exodeoxyribonuclease 7 large subunit EC=3.1.11.6 ; Cytoplasm Exonuclease Hydrolase

Iprscan [coil]

266

287

-

Iprscan IPR003753 [MF_00378]

6

441

Exonuclease VII, large subunit

Iprscan IPR020579 [PF02601]

125

440

Exonuclease VII, large subunit, C-terminal

Iprscan IPR004365 [PF01336]

29

102

Nucleic acid binding, OB-fold, tRNA/helicase-type

Iprscan IPR003753 [TIGR00237]

10

440

Exonuclease VII, large subunit

Iprscan [seg]

373

384

-

PD013688

55

193

S=364 I=51 E=1.4458e-36

PD010734

195

268

S=298 I=70 E=1.43617e-28

PD407053

389

440

S=156 I=62 E=2.04208e-11

PDA003D7

1

52

S=140 I=56 E=1.80442e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aFRkM5h3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr24210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr24210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr24210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr24210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
tatD2 XFF4834R_chr30290
XFF4834R_chr30280
XFF4834R_chr30280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30300
XFF4834R_chr30300
ID tatD2
AC XFF4834R_chr30290
LT XFF4834R_chr30290
OR XFF4834R_chr from 3481808 to 3482575 on strand +
DE putative deoxyribonuclease, TatD (DNase TatD)
IP Deoxyribonuclease, TatD-related; Deoxyribonuclease, TatD Mg-dependent; Deoxyribonuclease, TatD-related, conserved site
CL 2.1.5 DNA degradation GO:0006308
EC
GO InterPro
producing 5'-phosphomonoesters (GO:0016888)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130522)
MW 27907.5 Da
SQ 255 aa
 
........10........20........30........40........50
| | | | |
MRLIDSHCHLDAGEFDHDRAAVIARAQAAGVVQQVVPAITAASWPGLRAV
CDQAPGLHPAYGLHPLFLEQHRPAHLQELAEWIERERPCAIGECGLDFFV
DGLDAQAQRDYFDAQLQLAKRFDLPLIVHARRATEEVIARIKAVGGLRGV
VHSFAGSPEQAQQLWKLDFMIGLGGPVTYPRANRLRGLVASMPLQHLLLE
TDAPDQPDAGIRGQRNEPAYLRTVLDCIAQLRGQDPAHIAAQTSANACNL
FGLPH
XFF4834R

XFF4834R_chr02880 lcl|tatD-XFF4834R_chr02880

1

254

S=236 I=32 E=3.32536e-22

DNase, magnesium-dependent

XFF4834R

YP_363257.1 lcl|XCV1526

1

253

S=1130 I=88 E=5.46651e-130

putative TatD related DNase

XFF4834R

NP_636799.1 lcl|XCC1426

1

254

S=1040 I=80 E=4.3557e-119

hypothetical protein

XFF4834R

lcl|XALc_1135

1

253

S=810 I=67 E=3.73341e-91

conserved hypothetical protein.

XFF4834R

NP_641803.1 lcl|XAC1469-XAC1469

177

255

S=390 I=96 E=2.29349e-40

hypothetical protein

XFF4834R

NP_635694.1 lcl|mttC-XCC0299

1

254

S=251 I=31 E=1.83424e-23

type V secretory pathway protein

XFF4834R

YP_362053.1 lcl|XCV0322

1

254

S=240 I=32 E=3.58636e-22

TatD-related DNase

XFF4834R

lcl|tatD-XALc_3011

1

254

S=240 I=32 E=3.98192e-22

probable tatd-related deoxyribonuclease protein

XFF4834R

NP_640669.1 lcl|mttC-XAC0313

1

235

S=237 I=31 E=8.57639e-22

type V secretory pathway protein

pubmed

3

253

S=357 I=32 E=8.94546e-35

Uncharacterized deoxyribonuclease yabD EC=3.1.21.- ; Hydrolase

Pubmed 7584024

 

prodomImg

pubmed

1

254

S=350 I=34 E=5.88149e-34

Sec-independent protein TatD EC=3.1.21.- ; Hydrolase

Pubmed 12446909

 

prodomImg

pubmed

62

253

S=243 I=36 E=6.13044e-21

MttC

Pubmed 9546395

 

prodomImg

pubmed

62

253

S=239 I=36 E=1.83904e-20

Deoxyribonuclease tatD EC=3.1.21.- ; Cytoplasm Hydrolase Magnesium

Pubmed 1584020,9649434

 

prodomImg

pubmed

57

255

S=224 I=33 E=1.37693e-18

TatD-like protein

Pubmed 19246593

 

prodomImg

pubmed

50

253

S=203 I=29 E=3.98235e-16

Cell death-related nuclease 2 Cell-death-related nuclease protein 2

Pubmed 12718884

 

prodomImg

pubmed

87

204

S=162 I=37 E=3.63464e-11

Uncharacterized deoxyribonuclease C17A3.08 EC=3.1.21.- ; Cytoplasm Hydrolase Nucleus

Pubmed 10620777

 

prodomImg

pubmed

60

204

S=159 I=29 E=1.04383e-10

Putative deoxyribonuclease TATDN2 EC=3.1.21.- ; Hydrolase Nucleus Phosphoprotein Polymorphism

Pubmed 9039502

 

prodomImg

pubmed

57

251

S=157 I=26 E=1.50543e-10

Putative uncharacterized protein

Pubmed 9023221

 

prodomImg

sp_Pdown

sp|P39408|YJJV_ECOLI

2

254

S=423 I=38 E=6.96103e-43

Uncharacterized deoxyribonuclease yjjV EC=3.1.21.- ; Hydrolase

sp_Pdown

sp|P37545|YABD_BACSU

3

253

S=357 I=32 E=6.17372e-35

Uncharacterized deoxyribonuclease yabD EC=3.1.21.- ; Hydrolase

Iprscan [G3DSA:3.20.20.140]

3

251

-

Iprscan IPR012278 [PIRSF005902]

1

255

Deoxyribonuclease, TatD Mg-dependent

Iprscan IPR001130 [PF01026]

4

252

Deoxyribonuclease, TatD-related

Iprscan IPR018228 [PS01090]

125

135

Deoxyribonuclease, TatD-related, conserved site

Iprscan IPR018228 [PS01091]

188

204

Deoxyribonuclease, TatD-related, conserved site

Iprscan IPR018228 [PS01137]

3

11

Deoxyribonuclease, TatD-related, conserved site

Iprscan [seg]

20

38

-

PD588826

177

255

S=185 I=50 E=6.21503e-15

PDA7X2V7

39

102

S=121 I=41 E=3.88917e-07

PDA7X2T8

39

93

S=119 I=42 E=5.65818e-07

PD403160

94

173

S=116 I=39 E=1.50233e-06

PDA7X2T7

48

93

S=102 I=39 E=6.49435e-05

PDA1P482

57

97

S=101 I=49 E=8.81177e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dedU6ijb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr30290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr30290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr30290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT4br0Z/XFF4834R_chr30290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.