Xanthomonas fuscans subsp. fuscans

9 hits

  1. XFF4834R_chr00030recFXFF4834R_chr00030recombination protein F
  2. XFF4834R_chr06450xerCXFF4834R_chr06450site-specific tyrosine recombinase XerC
  3. XFF4834R_chr34460xerDXFF4834R_chr34460probable tyrosine recombinase protein, XerD
  4. XFF4834R_chr40980rdgCXFF4834R_chr40980probable recombination-associated protein RdgC
  5. XFF4834R_chr42330XFF4834R_chr_4917470_4919152_r3_XFF4834R-XFF4834R_chr42330XFF4834R_chr42330putative DNA recombination muC homologue protein
  6. XFF4834R_chr42430XFF4834R_chr_4926531_4927493_f3_XFF4834R-XFF4834R_chr42430XFF4834R_chr42430resolvase
  7. XFF4834R_plb00130XFF4834R_plb00090035_0010925_r1_XFF4834R-XFF4834R_plb00130XFF4834R_plb00130putative resolvase
  8. XFF4834R_plb00140XFF4834R_plb00100013_0011981_r1_XFF4834R-XFF4834R_plb00140XFF4834R_plb00140putative resolvase
  9. XFF4834R_plc00220XFF4834R_plc00160146_0017841_f1_XFF4834R-XFF4834R_plc00220XFF4834R_plc00220putative resolvase

recF XFF4834R_chr00030
XFF4834R_chr_0004
XFF4834R_chr_0004
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00040
XFF4834R_chr00040
ID recF
AC XFF4834R_chr00030
LT XFF4834R_chr00030
OR XFF4834R_chr from 3740 to 4846 on strand +
DE recombination protein F
IP DNA-binding, RecF; RecF/RecN/SMC protein, N-terminal
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro
Biological Process: DNA repair (GO:0006281)
Cellular Component: chromosome (GO:0005694)
Molecular Function: single-stranded DNA binding (GO:0003697)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: curated by royer (20100323)
MW 40512.6 Da
SQ 368 aa
 
........10........20........30........40........50
| | | | |
MHVVRLSIHRLRRFQTVELHPSSALNLLTGDNGAGKTSVLEALHLMAYGR
SFRGRVRDGLIQQGANDLEVFVEWKEGGGAAGERTRRAGLRHSGQEWTGR
LDGEDVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHVEPD
FLTLWRRYARALKQRNALLKQGAQPRLLDAWDNELAESGENLTSRRMRYL
ERLQDRMVPVADAIAPALGLSALTFAPGWKRHEVSLADALLLARDRDRQN
GYTSPGPHRADWMPSFLALPGKDALSRGQAKLTALACLLAQAEDFAFERG
EWPVIALDDLGSELDRHHQGRVLQRLASAPAQVLITATETPPGLADAAAL
LQQFHVEHGQIARQVAAN
pubmed

1

368

S=1539 I=80 E=9.59352e-178

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 12039751

 

prodomImg

pubmed

1

361

S=442 I=33 E=8.21882e-45

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 2172087

 

prodomImg

pubmed

1

362

S=438 I=33 E=2.25966e-44

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 6379647,6089112

 

prodomImg

pubmed

1

362

S=428 I=32 E=3.49146e-43

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 1542576

 

prodomImg

pubmed

1

337

S=409 I=33 E=8.19141e-41

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 1741300

 

prodomImg

pubmed

1

363

S=405 I=33 E=2.37308e-40

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 1542576,2540413

 

prodomImg

pubmed

1

362

S=297 I=28 E=2.67544e-27

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 18281406

 

prodomImg

pubmed

1

338

S=283 I=28 E=1.62495e-25

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 10427704

 

prodomImg

pubmed

1

338

S=276 I=26 E=1.16571e-24

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 7898435,1311298

 

prodomImg

pubmed

1

340

S=270 I=24 E=4.9562e-24

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 17592475

 

prodomImg

sp_Pdown

sp|Q8PRG0|RECF_XANAC

1

368

S=1710 I=90 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

sp_Pdown

sp|Q3BZS9|RECF_XANC5

1

368

S=1654 I=87 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

sp_Pdown

sp|Q5H713|RECF_XANOR

1

368

S=1612 I=85 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

sp_Pdown

sp|Q2P9L9|RECF_XANOM

1

361

S=1601 I=85 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

sp_Pdown

sp|Q8PEH3|RECF_XANCP

1

368

S=1545 I=80 E=1.15425e-178

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Iprscan [G3DSA:3.40.50.300]

1

66

-

Iprscan IPR003395 [PF02463]

3

340

RecF/RecN/SMC protein, N-terminal

Iprscan IPR001238 [TIGR00611]

1

361

DNA-binding, RecF

Iprscan [seg]

76

89

-

Iprscan [seg]

236

248

-

PDA1K1O4

168

234

S=297 I=84 E=1.70132e-28

PD003952

47

167

S=164 I=38 E=2.19971e-12

PD358672

249

362

S=163 I=38 E=2.9076e-12

Iprscan [SSF52540]

1

337

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9WQcUjF4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

43 hits
swiss-prot

Swiss-Prot ncbi-blastp

386 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr00030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr00030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr00030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr00030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
xerC XFF4834R_chr06450
XFF4834R_chr06440
XFF4834R_chr06440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06460
XFF4834R_chr06460
ID xerC
AC XFF4834R_chr06450
LT XFF4834R_chr06450
OR XFF4834R_chr from 734300 to 735217 on strand +
DE site-specific tyrosine recombinase XerC
IP Integrase, catalytic core, phage; Integrase, N-terminal SAM-like, phage
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro
Biological Process: cell division (GO:0051301)
Biological Process: chromosome segregation (GO:0007059)
Biological Process: cell cycle (GO:0007049)
Biological Process: DNA integration (GO:0015074)
Biological Process: DNA recombination (GO:0006310)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101103)
MW 33783.1 Da
SQ 305 aa
 
........10........20........30........40........50
| | | | |
MSSVDEFLTYLQVERQVSAHTLDAYRRDLAALVVWAAEQTTDDGVQDAAV
PAETAQFDSAHLRQFVAAEHRRGLSAKSLQRRLSACRSYYAWLLKHGRIS
ASPAAVLRAPKAPRKLPQVLDADEAVRLVEVPTDAPLGLRDRALLEVFYS
SGLRLSELCALRWRDLDLDSGLVMVLGKGSKQRLVPVGSHAIAALREWRR
DSGASADSHVFPGRAGGAISQRAVQIRIKQLAVRQGMFKDVHPHMLRHSF
ASHILESSGDLRGVQELLGHSDIATTQIYTHLDFQHLAKVYDAAHPRARR
KKAAE
Hamap XERC_MF_01808 raw_score=6159 norm_score=35.365

Tyrosine recombinase xerC [xerC].

XFF4834R

XFF4834R_chr34460 lcl|xerD-XFF4834R_chr34460

2

296

S=403 I=36 E=2.30838e-42

site-specific tyrosine recombinase

XFF4834R

XFF4834R_chr25960 lcl|XFF4834R_chr28450106_3001756_f2_XFF4834R-XFF4834R_chr25960

150

288

S=99 I=27 E=1.63521e-05

XFF4834R

NP_640989.1 lcl|xerC-XAC0636

1

296

S=1510 I=99 E=6.05112e-176

site-specific tyrosine recombinase XerC

XFF4834R

YP_362422.1 lcl|xerC-XCV0691

1

296

S=1497 I=98 E=2.12192e-174

site-specific tyrosine recombinase XerC

XFF4834R

NP_638843.1 lcl|xerC-XCC3497

1

296

S=1303 I=85 E=7.36938e-151

site-specific tyrosine recombinase XerC

XFF4834R

lcl|xerC-XALc_2575

4

296

S=1149 I=78 E=3.64256e-132

probable tyrosine recombinase protein

XFF4834R

lcl|xerD-XALc_2669

2

296

S=415 I=37 E=2.67235e-43

probable tyrosine recombinase protein

XFF4834R

NP_636046.1 lcl|xerD-XCC0654

3

296

S=412 I=38 E=7.94705e-43

site-specific tyrosine recombinase XerD

XFF4834R

YP_365407.1 lcl|xerD-XCV3676

2

296

S=407 I=37 E=2.93888e-42

site-specific tyrosine recombinase XerD

XFF4834R

NP_643858.2 lcl|xerD-XAC3551

2

296

S=404 I=37 E=6.00724e-42

site-specific tyrosine recombinase XerD

XFF4834R

NP_635739.1 lcl|XCC0344

236

282

S=156 I=64 E=7.61009e-12

site-specific recombinase

XFF4834R

NP_635739.1 lcl|XCC0344

55

187

S=106 I=33 E=8.11906e-06

site-specific recombinase

pubmed

4

296

S=1082 I=72 E=1.66877e-122

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 12050668

 

prodomImg

pubmed

2

296

S=731 I=51 E=5.75433e-80

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 2254268,1379743

 

prodomImg

pubmed

2

296

S=726 I=55 E=2.51139e-79

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 7715441

 

prodomImg

pubmed

4

296

S=711 I=51 E=1.55214e-77

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 9370270

 

prodomImg

pubmed

4

296

S=677 I=49 E=1.9747e-73

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 9555916

 

prodomImg

pubmed

4

296

S=672 I=51 E=7.628e-73

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 9618537,11872710

 

prodomImg

pubmed

3

296

S=669 I=46 E=2.11559e-72

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 9675854

 

prodomImg

pubmed

1

296

S=606 I=42 E=7.12859e-65

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 10048034

 

prodomImg

pubmed

4

296

S=593 I=42 E=3.24708e-63

Tyrosine recombinase xerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 12050668

 

prodomImg

pubmed

7

296

S=554 I=44 E=1.66688e-58

Site-specific recombinase XerC ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 15305924

 

prodomImg

Iprscan [G3DSA:1.10.150.130]

4

107

-

Iprscan IPR013762 [G3DSA:1.10.443.10]

118

292

Integrase-like, catalytic core, phage

Iprscan [MF_01808]

1

298

-

Iprscan IPR004107 [PF02899]

4

97

Integrase, N-terminal SAM-like, phage

Iprscan IPR002104 [PF00589]

128

289

Integrase, catalytic core, phage

Iprscan IPR011931 [TIGR02224]

5

300

Tyrosine recombinase XerC

Iprscan [seg]

297

304

-

PD969499

89

253

S=191 I=32 E=1.18844e-15

PDA11488

4

192

S=170 I=30 E=3.78319e-13

PD824474

26

279

S=159 I=21 E=7.39702e-12

PDA027R6

89

296

S=154 I=32 E=3.37216e-11

PDA1T7W1

176

217

S=145 I=67 E=4.53197e-10

PD254221

254

296

S=135 I=60 E=5.98539e-09

PD962710

151

279

S=130 I=35 E=2.85021e-08

PD888590

136

175

S=130 I=57 E=3.02958e-08

PD542197

93

176

S=125 I=38 E=1.13017e-07

PDA2S7L7

6

124

S=118 I=30 E=7.05197e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gJc5Zeq6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

370 hits
swiss-prot

Swiss-Prot ncbi-blastp

286 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr06450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr06450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr06450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr06450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
xerD XFF4834R_chr34460
XFF4834R_chr_3661
XFF4834R_chr_3661
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34470
XFF4834R_chr34470
ID xerD
AC XFF4834R_chr34460
LT XFF4834R_chr34460
OR XFF4834R_chr from 3995681 to 3996652 on strand -
DE probable tyrosine recombinase protein, XerD
IP Tyrosine recombinase XerD; Tyrosine recombinase XerD-like
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro
Biological Process: DNA integration (GO:0015074)
Biological Process: cell cycle (GO:0007049)
Biological Process: DNA recombination (GO:0006310)
Biological Process: cell division (GO:0051301)
Biological Process: chromosome segregation (GO:0007059)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101103)
MW 35857.6 Da
SQ 323 aa
 
........10........20........30........40........50
| | | | |
MSASSPAERRQLARHLPPVQPADASVIERFLDRFWAEQGVARQTLESYRR
DLEGLARWRDGAGGGLLGIDRAALFDYLRWRTRANYSPRSTARLLSTLRA
FYGLCLRDGVRSDDPTALIDPPQLPRSLPKALTESQIEALLDAPDLDTPA
GLRDRAMLELMYAAGLRVSELVNLPAVGVNLRQGVLRVTGKGSKDRLVPL
GEESQHWLERYLREARPLLAANKPVTAVDGQVPLFIDVSRQPLSRQQFWA
LVKRYAAVAGIDPAAVSPHGLRHSFATHLLNHGADLRALQMLLGHSSLST
TQIYTLVARQHLQKLHASHHPRG
XFF4834R

XFF4834R_chr06450 xerC-XFF4834R_chr06450

25

323

S=409 I=36 E=4.30929e-43

site-specific tyrosine recombinase

XFF4834R

NP_643858.2 xerD-XAC3551

1

323

S=1634 I=98 E=0

site-specific tyrosine recombinase XerD

XFF4834R

YP_365407.1 xerD-XCV3676

1

323

S=1590 I=96 E=0

site-specific tyrosine recombinase XerD

XFF4834R

NP_636046.1 xerD-XCC0654

1

323

S=1412 I=85 E=4.68148e-164

site-specific tyrosine recombinase XerD

XFF4834R

XALc_2669 xerD-XALc_2669

5

323

S=1216 I=74 E=3.07255e-140

probable tyrosine recombinase protein

XFF4834R

NP_638843.1 xerC-XCC3497

18

322

S=441 I=37 E=2.38604e-46

site-specific tyrosine recombinase XerC

XFF4834R

XALc_2575 xerC-XALc_2575

27

323

S=423 I=37 E=3.81438e-44

probable tyrosine recombinase protein

XFF4834R

YP_362422.1 xerC-XCV0691

25

323

S=410 I=37 E=1.47221e-42

site-specific tyrosine recombinase XerC

XFF4834R

NP_640989.1 xerC-XAC0636

25

323

S=405 I=36 E=5.122e-42

site-specific tyrosine recombinase XerC

XFF4834R

NP_635739.1 XCC0344

260

307

S=134 I=60 E=3.54648e-09

site-specific recombinase

XFF4834R

YP_362087.1 XCV0356

238

307

S=131 I=46 E=7.90963e-09

putative integrase

pubmed

1

323

S=1095 I=65 E=5.86315e-124

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 12050668

 

prodomImg

pubmed

20

323

S=800 I=53 E=3.43129e-88

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 9675854

 

prodomImg

pubmed

23

323

S=791 I=54 E=3.36916e-87

Site-specific recombinase ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 15758242

 

prodomImg

pubmed

23

323

S=774 I=51 E=4.80887e-85

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 12050668

 

prodomImg

pubmed

23

323

S=749 I=52 E=4.10013e-82

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Pubmed 9370270

 

prodomImg

sp_Pdown

sp|Q8PGR5|XERD_XANAC

19

323

S=1542 I=98 E=2.74772e-178

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

sp_Pdown

sp|Q8PCQ9|XERD_XANCP

1

323

S=1412 I=85 E=1.3264e-162

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

sp_Pdown

sp|Q9PDF4|XERD_XYLFA

1

323

S=1095 I=65 E=3.99153e-124

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

sp_Pdown

sp|Q87DN0|XERD_XYLFT

1

323

S=1093 I=66 E=5.8071e-124

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

sp_Pdown

sp|Q9HXQ6|XERD_PSEAE

26

323

S=853 I=58 E=8.3914e-95

Tyrosine recombinase xerD ; Cell cycle division Chromosome partition Cytoplasm DNA integration recombination DNA-binding

Iprscan [G3DSA:1.10.150.130]

22

119

-

Iprscan IPR013762 [G3DSA:1.10.443.10]

130

317

Integrase-like, catalytic core, phage

Iprscan [MF_01807]

23

323

-

Iprscan [MF_01808]

23

323

-

Iprscan IPR002104 [PF00589]

130

311

Integrase, catalytic core, phage

Iprscan IPR004107 [PF02899]

27

104

Integrase, N-terminal SAM-like, phage

Iprscan IPR011932 [TIGR02225]

28

323

Tyrosine recombinase XerD

PDA0S8K3

30

180

S=174 I=31 E=1.43516e-13

PDA11488

27

212

S=173 I=29 E=1.91362e-13

PD969499

101

278

S=163 I=33 E=3.06172e-12

PDA30268

1

43

S=156 I=72 E=2.23505e-11

PDA97358

19

219

S=144 I=32 E=5.57838e-10

PDA027R6

101

322

S=142 I=32 E=1.11082e-09

PD888590

149

188

S=136 I=70 E=5.77154e-09

PD631017

243

278

S=129 I=67 E=3.60129e-08

PD799078

161

305

S=129 I=32 E=4.4395e-08

PDA1E017

101

148

S=127 I=50 E=6.98606e-08

Iprscan IPR011010 [SSF56349]

125

321

DNA breaking-rejoining enzyme, catalytic core

Iprscan IPR010998 [SSF47823]

23

133

Integrase, Lambda-type, N-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Y4jlhVTz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

311 hits
swiss-prot

Swiss-Prot ncbi-blastp

344 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr34460.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr34460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr34460.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr34460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rdgC XFF4834R_chr40980
XFF4834R_chr40970
XFF4834R_chr40970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40990
XFF4834R_chr40990
ID rdgC
AC XFF4834R_chr40980
LT XFF4834R_chr40980
OR XFF4834R_chr from 4755340 to 4756245 on strand -
DE probable recombination-associated protein RdgC
IP Putative exonuclease, RdgC
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro
Biological Process: DNA recombination (GO:0006310)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101104)
MW 33395.9 Da
SQ 301 aa
 
........10........20........30........40........50
| | | | |
MFFRNLTLFRFPTTLDLSEIDTLLPQVQLKPVGPLEMSSRGFISPFGRDE
QEVLSHRLEDFLWLTVGGEDKILPGAVVNDLLERKVAEIEEKEGRRPGGK
ARKRLKDDLIHELLPRAFVKSSRTDAILDLQHGYIAVNSSSRKSGENVMS
EIRGALGSFPALPLNAEVAPRAILTGWIAGEPLPEGLSLGEECEMKDPIE
GGAVVKCQHQELRGDEIDKHLEAGKQVTKLALVLDDNLSFVLGDDLVIRK
LKFLDGALDQLEHSEDDGARAELDARFALMSAEIRRLFLLLETALKLSKA
E
Hamap RDGC_MF_00194 raw_score=7619 norm_score=40.209

Recombination-associated protein rdgC [rdgC].

XFF4834R

YP_366058.1 lcl|rdgC-XCV4327

1

301

S=1435 I=94 E=8.73105e-167

recombination associated protein

XFF4834R

NP_644522.1 lcl|rdgC-XAC4223

1

301

S=1432 I=94 E=1.76919e-166

recombination associated protein

XFF4834R

NP_639437.1 lcl|rdgC-XCC4098

1

301

S=1416 I=92 E=1.59078e-164

recombination associated protein

XFF4834R

lcl|rdgC-XALc_0066

1

301

S=1309 I=85 E=1.40498e-151

probable recombination-associated protein rdgc.

XFF4834R

YP_361693.1 lcl|rdgC-XCVd0134

2

301

S=1182 I=75 E=3.12159e-136

recombination associated protein

pubmed

1

288

S=418 I=32 E=5.05524e-42

Recombination-associated protein rdgC ; Cytoplasm DNA

Pubmed 8807285

 

prodomImg

pubmed

3

295

S=406 I=32 E=1.2079e-40

HrdC

Pubmed 15489417

 

prodomImg

pubmed

1

289

S=391 I=29 E=8.96527e-39

ORF10

Pubmed 12452967

 

prodomImg

pubmed

1

269

S=391 I=32 E=9.95408e-39

Recombination-associated protein rdgC ; Cytoplasm DNA

Pubmed 10655208

 

prodomImg

pubmed

31

295

S=390 I=37 E=1.28177e-38

RdgC exonuclease

Pubmed 15716012

 

prodomImg

pubmed

1

287

S=370 I=32 E=3.1687e-36

Recombination-associated protein rdgC ; Cytoplasm DNA

Pubmed 10675023

 

prodomImg

pubmed

4

277

S=350 I=31 E=9.00609e-34

Recombination associate protein ; Cytoplasm DNA Plasmid

Pubmed 17921277

 

prodomImg

sp_Pdown

sp|Q8PEW7|RDGC_XANAC

1

301

S=1432 I=94 E=4.5551e-165

Recombination-associated protein rdgC ; Cytoplasm DNA

sp_Pdown

sp|Q2NXR4|RDGC_XANOM

1

301

S=1422 I=93 E=7.88289e-164

Recombination-associated protein rdgC ; Cytoplasm DNA

sp_Pdown

sp|Q8P3H3|RDGC_XANCP

1

301

S=1416 I=92 E=4.09576e-163

Recombination-associated protein rdgC ; Cytoplasm DNA

sp_Pdown

sp|B0RYY7|RDGC_XANCB

1

301

S=1416 I=92 E=4.09576e-163

Recombination-associated protein rdgC ; Cytoplasm DNA

sp_Pdown

sp|Q4UNZ6|RDGC_XANC8

1

301

S=1416 I=92 E=4.09576e-163

Recombination-associated protein rdgC ; Cytoplasm DNA

Iprscan [MF_00194]

1

300

-

Iprscan IPR007476 [PF04381]

1

300

Putative exonuclease, RdgC

Iprscan [seg]

180

194

-

PD040489

69

178

S=234 I=51 E=7.38443e-21

PD718513

220

288

S=178 I=57 E=4.62481e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one URC9WAPp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

127 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr40980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr40980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr40980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr40980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4917470_4919152_r3_XFF4834R-XFF4834R_chr42330 XFF4834R_chr42330
XFF4834R_chr42320
XFF4834R_chr42320
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4612
XFF4834R_chr_4612
ID XFF4834R_chr_4917470_4919152_r3_XFF4834R-XFF4834R_chr42330
AC XFF4834R_chr42330
LT XFF4834R_chr42330
OR XFF4834R_chr from 4917470 to 4919152 on strand -
DE putative DNA recombination muC homologue protein
IP RmuC
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100916)
MW 62639.4 Da
SQ 560 aa
 
........10........20........30........40........50
| | | | |
MAAVVQLHPAALARERAGQAPRRSCCDKHRYTAHMSSQSLILLGLLVVVL
VLQLLALLRRPSTTALEHALRAEQRDGRGELREQLEGLARQQDARLETFA
RNLAELSTRTDQRLDLLRDALGEDARKAREESGLAQQRIGELLTLRLTEL
RTQLEGFGQQQETRIQVFGQQLTELMARTDTHMAALREALAEDARKGRQE
AGQSQQRFTEALGLRLNELTQRNELRIGEMRATLEQQLANLQHDNASKLE
LMRATVDEKLQTTLNTRLDASFKLVSERLEQVQRGLGEMQQLATGVGDLK
RVLTNVKDRGGWGEVQLDNILEQTLTMEQYARGVRVKPDSAEAVDFAIRL
PGRGDEKVVWLPVDAKFPREDYERLIDAQEKGDLDAIKQSTAQLERAIRI
QAKSISDKYVCPPHTTDFAVMFLPTEGLYAEVIRRAGLVDLLQREHRVVL
AGPTTFTGLLNSLQMGFRTLAIEKRSSEVWQVLGAVKSEFGKFAGILEKA
ERQISTVGKSLGEASRKTRTIERRLRGVETLAGDQSQALLDDGSDDTGTS
SEDDSNDEQA
XFF4834R

NP_644642.2 lcl|XAC4348-XAC4348

59

540

S=2280 I=93 E=0

hypothetical protein

XFF4834R

NP_639549.2 lcl|XCC4215

59

540

S=2173 I=89 E=0

hypothetical protein

XFF4834R

YP_366190.1 lcl|XCV4459

81

540

S=2161 I=92 E=0

RmuC family DNA recombination protein

XFF4834R

lcl|XALc_0034

64

540

S=1789 I=74 E=0

hypothetical protein

pubmed

297

512

S=136 I=24 E=1.73131e-07

RmuC family protein

Pubmed 17675438

 

prodomImg

pubmed

284

525

S=128 I=26 E=1.32017e-06

DNA recombination protein rmuC ; Coiled

Pubmed 2674901,10886369

 

prodomImg

sp_Pdown

sp|Q9PG89|RMUC_XYLFA

160

540

S=1441 I=74 E=7.31974e-166

DNA recombination protein rmuC homolog ; Coiled

sp_Pdown

sp|Q9PG89|RMUC_XYLFA

59

140

S=223 I=60 E=2.70501e-18

DNA recombination protein rmuC homolog ; Coiled

sp_Pdown

sp|Q87AZ9|RMUC_XYLFT

160

540

S=1438 I=73 E=2.0301e-165

DNA recombination protein rmuC homolog ; Coiled

sp_Pdown

sp|Q87AZ9|RMUC_XYLFT

59

140

S=224 I=60 E=2.6123e-18

DNA recombination protein rmuC homolog ; Coiled

sp_Pdown

sp|O84832|RMUC_CHLTR

280

514

S=161 I=29 E=9.8587e-11

DNA recombination protein rmuC homolog ; Coiled

Iprscan [coil]

231

252

-

Iprscan IPR003798 [PF02646]

246

546

RmuC

Iprscan [seg]

40

58

-

Iprscan [seg]

141

155

-

Iprscan [seg]

184

195

-

Iprscan [seg]

541

558

-

Iprscan [tmhmm]

40

57

-

PD041459

394

529

S=285 I=48 E=5.03748e-27

PD271755

59

114

S=254 I=93 E=2.75102e-23

PD719298

196

270

S=250 I=72 E=9.99761e-23

PDA1V7K0

115

183

S=214 I=68 E=2.42476e-18

PDA060O3

309

383

S=155 I=48 E=3.35751e-11

PD317459

271

307

S=137 I=76 E=4.75064e-09

PDA3C5M4

398

464

S=124 I=33 E=1.59483e-07

PDA8L150

228

307

S=122 I=34 E=3.34631e-07

PDA1V7J9

390

413

S=118 I=100 E=9.20029e-07

PDA060M0

253

390

S=118 I=25 E=1.05776e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rpFAm0ro)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42330.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42330.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4926531_4927493_f3_XFF4834R-XFF4834R_chr42430 XFF4834R_chr42430
XFF4834R_chr42420
XFF4834R_chr42420
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42440
XFF4834R_chr42440
ID XFF4834R_chr_4926531_4927493_f3_XFF4834R-XFF4834R_chr42430
AC XFF4834R_chr42430
LT XFF4834R_chr42430
OR XFF4834R_chr from 4926531 to 4927493 on strand +
DE resolvase
IP Recombinase, conserved site
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro
Biological Process: DNA recombination (GO:0006310)
Molecular Function: recombinase activity (GO:0000150)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 36278.8 Da
SQ 320 aa
 
........10........20........30........40........50
| | | | |
MTTFVRAYLRASTDEQDAQRARSGLDQFARDRGVRICNYYAENASGARLD
RAELFRLLADSRPHDVLLVEDVDRLSRLGRAEWEKLKTLIRERAVRVVAV
NVPTTWQHLAPLQNEFDARMFGAINDMLLDMLAAIARRDYEQRRQRQAQG
IAKAKVAGKYRGRQIDRARYGAINRLLTSGSSWSVVQKTVGCSRSTISQA
VKHAKLSAPAPRTELMAAASVAVILWLHVENGSKFTRGKKRVREDIDDLI
ATSHKSTKLSDTEYRLVIRYADDADLKQQIDDLLHEILHLADLRNCVVDD
MSVKHEATGSFWDECDGGWK
XFF4834R

XFF4834R_plb00140 lcl|XFF4834R_plb00100013_0011981_r1_XFF4834R-XFF4834R_plb00140

1

320

S=1595 I=96 E=0

XFF4834R

XFF4834R_plb00130 lcl|XFF4834R_plb00090035_0010925_r1_XFF4834R-XFF4834R_plb00130

25

320

S=1473 I=94 E=5.5484e-172

XFF4834R

XFF4834R_plc00220 lcl|XFF4834R_plc00160146_0017841_f1_XFF4834R-XFF4834R_plc00220

6

197

S=255 I=36 E=1.8307e-24

XFF4834R

YP_361524.1 lcl|tnpR-XCVc0008

1

320

S=1587 I=95 E=0

resolvase

XFF4834R

YP_361665.1 lcl|XCVd0106

182

320

S=525 I=71 E=1.42093e-56

putative resolvase

XFF4834R

NP_642748.1 lcl|parA-XAC2433

4

197

S=278 I=37 E=1.1845e-26

resolvase

XFF4834R

lcl|XALq_3232

4

193

S=260 I=36 E=1.89357e-24

putative resolvase protein

XFF4834R

YP_361668.1 lcl|tnpR-XCVd0109

7

312

S=150 I=26 E=3.79553e-11

Tn5045 resolvase

XFF4834R

YP_361556.1 lcl|XCVc0040

7

312

S=150 I=26 E=3.79553e-11

site-specific recombinase / resolvase family protein

XFF4834R

YP_361512.1 lcl|tnpR-XCVb0018

7

312

S=150 I=26 E=3.79553e-11

Tn5045 resolvase

XFF4834R

NP_644799.1 lcl|tnpR-XACb0071

7

312

S=150 I=26 E=3.79553e-11

Tn5045 resolvase

XFF4834R

NP_644724.1 lcl|tnpR-XACa0038

7

312

S=150 I=26 E=3.79553e-11

Tn5045 resolvase

pubmed

2

208

S=636 I=60 E=1.77036e-68

Resolvase ; Plasmid

Pubmed 15328093,18440636

 

prodomImg

pubmed

2

203

S=628 I=60 E=1.98117e-67

Putative resolvase ; Plasmid

Pubmed 17936903

 

prodomImg

pubmed

4

197

S=443 I=47 E=4.30047e-45

Res protein ; Plasmid

Pubmed 12534468

 

prodomImg

pubmed

4

197

S=440 I=47 E=1.1721e-44

Putative Res ; Plasmid

Pubmed 10974112

 

prodomImg

pubmed

4

197

S=438 I=49 E=1.89331e-44

Putative resolvase ; Plasmid

Pubmed 10880434

 

prodomImg

pubmed

4

197

S=430 I=48 E=1.68902e-43

Putative resolvase ; Plasmid

Pubmed 16707697,2175388

 

prodomImg

pubmed

4

204

S=427 I=45 E=3.79996e-43

Putative resolvase

Pubmed 15883889

 

prodomImg

pubmed

4

197

S=425 I=47 E=8.18449e-43

Putative resolvase ; Plasmid

Pubmed 15288784

 

prodomImg

pubmed

4

197

S=425 I=47 E=8.18449e-43

Putative resolvase ; Plasmid

Pubmed 10719200

 

prodomImg

pubmed

4

173

S=416 I=48 E=8.46788e-42

Putative resolvase

Pubmed 16159784

 

prodomImg

sp_Pdown

sp|P22996|PARA4_ECOLX

4

197

S=315 I=41 E=1.12936e-29

Resolvase ; DNA integration recombination DNA-binding Plasmid partition

Iprscan IPR006119 [G3DSA:3.40.50.1390]

3

143

Resolvase, N-terminal

Iprscan IPR006119 [PF00239]

5

160

Resolvase, N-terminal

Iprscan IPR006119 [SM00857]

5

160

Resolvase, N-terminal

Iprscan IPR006118 [PS00397]

8

16

Recombinase, conserved site

Iprscan [seg]

93

102

-

PD587108

223

312

S=206 I=47 E=1.94658e-17

PD976879

42

90

S=158 I=65 E=1.03387e-11

PD762468

4

40

S=125 I=62 E=1.31534e-07

PDA4M5G3

197

222

S=114 I=96 E=2.59432e-06

PD585694

103

141

S=114 I=60 E=2.59432e-06

PD867758

147

197

S=107 I=51 E=1.69091e-05

PDA4M5G5

182

211

S=105 I=70 E=3.42633e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gsdiXRrV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

95 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42430.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42430.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBShMaI8/XFF4834R_chr42430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plb00090035_0010925_r1_XFF4834R-XFF4834R_plb00130 XFF4834R_plb00130
XFF4834R_plb00120
XFF4834R_plb00120
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plb00140
XFF4834R_plb00140
ID XFF4834R_plb00090035_0010925_r1_XFF4834R-XFF4834R_plb00130
AC XFF4834R_plb00130
LT XFF4834R_plb00130
OR XFF4834R_plb from 10035 to 10925 on strand -
DE putative resolvase
IP Resolvase, N-terminal
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro
Biological Process: DNA recombination (GO:0006310)
Molecular Function: recombinase activity (GO:0000150)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 33500.7 Da
SQ 296 aa
 
........10........20........30........40........50
| | | | |
MDQFARDRGVRICNYYAENASGARLDRAELFRLLADSRPHDVLLVEDVDR
LSRLGRAEWEKLKTLIRERSVRVVAVNVPTTWQHLAPLQNEFDARMFGAI
NDMLLDMLAAIARRDYEQRRQRQAQGIAKAKVAGKYRGRQIDRARYGAIN
RLLASGSSWSVVQKTVGCSRSTISQAVKHAKLSASAPSTELMAAASVAVI
LWFHVENGSKFTRGKKRVREDIDDLIATSHKSTKLSDTEYRLVIRYADDA
DLKQQINDLLHEILHLADLRNCVVDDMSVKNEATGSFWDECDGGWK
XFF4834R

XFF4834R_chr42430 lcl|XFF4834R_chr_4926531_4927493_f3_XFF4834R-XFF4834R_chr42430

1

296

S=1473 I=97 E=5.05897e-172

XFF4834R

XFF4834R_plb00140 lcl|XFF4834R_plb00100013_0011981_r1_XFF4834R-XFF4834R_plb00140

1

296

S=1455 I=97 E=6.73428e-170

XFF4834R

XFF4834R_plc00220 lcl|XFF4834R_plc00160146_0017841_f1_XFF4834R-XFF4834R_plc00220

3

173

S=245 I=37 E=3.12447e-23

XFF4834R

YP_361524.1 lcl|tnpR-XCVc0008

1

296

S=1552 I=99 E=0

resolvase

XFF4834R

YP_361665.1 lcl|XCVd0106

158

296

S=525 I=71 E=1.30262e-56

putative resolvase

XFF4834R

NP_642748.1 lcl|parA-XAC2433

9

173

S=260 I=38 E=1.8776e-24

resolvase

XFF4834R

lcl|XALq_3232

5

169

S=247 I=37 E=6.24854e-23

putative resolvase protein

XFF4834R

YP_361668.1 lcl|tnpR-XCVd0109

16

288

S=172 I=27 E=9.26176e-14

Tn5045 resolvase

XFF4834R

YP_361556.1 lcl|XCVc0040

16

288

S=172 I=27 E=9.26176e-14

site-specific recombinase / resolvase family protein

XFF4834R

YP_361512.1 lcl|tnpR-XCVb0018

16

288

S=172 I=27 E=9.26176e-14

Tn5045 resolvase

XFF4834R

NP_644799.1 lcl|tnpR-XACb0071

16

288

S=172 I=27 E=9.26176e-14

Tn5045 resolvase

XFF4834R

NP_644724.1 lcl|tnpR-XACa0038

16

288

S=172 I=27 E=9.26176e-14

Tn5045 resolvase

XFF4834R

YP_364169.1 lcl|XCV2438

213

289

S=97 I=30 E=9.03351e-05

cointegrate resolution protein S

pubmed

1

186

S=607 I=61 E=5.43799e-65

Resolvase ; Plasmid

Pubmed 15328093,18440636

 

prodomImg

pubmed

1

179

S=593 I=62 E=2.61004e-63

Putative resolvase ; Plasmid

Pubmed 17936903

 

prodomImg

pubmed

1

173

S=404 I=46 E=2.04106e-40

Putative Res ; Plasmid

Pubmed 10974112

 

prodomImg

pubmed

1

173

S=401 I=45 E=5.9648e-40

Res protein ; Plasmid

Pubmed 12534468

 

prodomImg

pubmed

1

173

S=400 I=48 E=6.91777e-40

Putative resolvase ; Plasmid

Pubmed 10880434

 

prodomImg

pubmed

1

173

S=395 I=47 E=2.94121e-39

Putative resolvase ; Plasmid

Pubmed 16707697,2175388

 

prodomImg

pubmed

1

173

S=389 I=47 E=1.40059e-38

Putative resolvase ; Plasmid

Pubmed 15288784

 

prodomImg

pubmed

1

173

S=389 I=47 E=1.40059e-38

Putative resolvase ; Plasmid

Pubmed 10719200

 

prodomImg

pubmed

4

173

S=381 I=45 E=1.2604e-37

Putative resolvase

Pubmed 15883889

 

prodomImg

pubmed

1

149

S=379 I=48 E=2.26051e-37

Putative resolvase

Pubmed 16159784

 

prodomImg

Iprscan IPR006119 [G3DSA:3.40.50.1390]

6

119

Resolvase, N-terminal

Iprscan IPR006119 [PF00239]

3

136

Resolvase, N-terminal

Iprscan IPR006119 [SM00857]

2

136

Resolvase, N-terminal

PD587108

198

288

S=204 I=45 E=2.857e-17

PD976879

18

72

S=168 I=64 E=8.61679e-13

PD585694

73

117

S=129 I=57 E=4.01889e-08

PDA4M5G3

173

198

S=110 I=96 E=7.51639e-06

PDA4M5G5

158

188

S=107 I=68 E=1.75106e-05

PD867758

123

173

S=107 I=51 E=1.94419e-05

PDA7P6K4

54

129

S=101 I=36 E=9.58669e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO