Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr13520XFF4834R_chr13520putative DNA methylase N-terminal fragment, pseudogene
  2. XFF4834R_chr28660XFF4834R_chr31210385_3299353_f2_XFF4834R-XFF4834R_chr28660XFF4834R_chr28660putative restriction endonuclease, type IV-like
  3. XFF4834R_chr33750XFF4834R_chr36570333_3896512_r3_XFF4834R-XFF4834R_chr33750XFF4834R_chr33750probable type I restriction-modification system endonuclease
  4. XFF4834R_chr42740XFF4834R_chr_4951849_4952112_f1_XFF4834R-XFF4834R_chr42740XFF4834R_chr42740putative Type-2 restriction endonuclease BsuBI/PstI
  5. XFF4834R_plc00240XFF4834R_plc00240Probable Type II restriction endonuclease XcyI
  6. XFF4834R_plc00430XFF4834R_plc_0036603_0037172_f3_XFF4834R-XFF4834R_plc00430XFF4834R_plc00430putative restriction endonuclease protein

XFF4834R_chr13520

Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence

ID
AC XFF4834R_chr13520
LO XFF4834R_chr13520
DE putative DNA methylase N-terminal fragment, pseudogene
CL 2.1.2 DNA restriction/modification GO:0006304 GO:0009307
GO InterPro


Curated
PM
AN The pseudogene XFF4834R_chr13520 replaces ORF XFF4834R_chr_1460 which corresponded to the N-terminal fragment (8%) of a putative DNA methylase (XCV2165) predicted in Xav.
CC MODEL:
CC STATUS: curated by darrasse (20120413)
SQ 306 nt
 
........10........20........30........40........50
| | | | |
ATGAACGCAGTTGAGATTGAAGAGGCACTATCAGCTCTGGCTGAGGCCCC
GTTTGAGCCGGCAGAATTCCCATATCAATTCCTGACAGCGTTTGGGAACA
AAGACACCACTATCAAGCGTCTGCGAAAGGGGGATAGCAACGCGTCCGAC
GTTCCGGGCGCTGTCTTGCAACGAAGCAACATCCATCTGGCCACCTGTGC
CCCAGGAAAGGTCCACGAGACCTTGCAAGTGTTGCGCGAGAGTCCTCGGA
ATCTGCCAGCCAAAGCCAAGTTCATCCTGGCGGAGCGTGTGCAGAATTTT
GTGTAA
Show or not Domain decomposition
 
Iprscan [seg]

3

23

-

Iprscan [seg]

31

45

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Bo7m9G3A)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr13520.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr13520.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr13520.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr13520.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31210385_3299353_f2_XFF4834R-XFF4834R_chr28660 XFF4834R_chr28660
XFF4834R_chr_3022
XFF4834R_chr_3022
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28670
XFF4834R_chr28670
ID XFF4834R_chr31210385_3299353_f2_XFF4834R-XFF4834R_chr28660
AC XFF4834R_chr28660
LT XFF4834R_chr28660
OR XFF4834R_chr from 3298361 to 3299353 on strand +
DE putative restriction endonuclease, type IV-like
IP Restriction endonuclease, type IV-like, Mrr
CL 2.1.2 DNA restriction/modification GO:0006304 GO:0009307
EC
GO InterPro
Biological Process: DNA restriction-modification system (GO:0009307)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: endonuclease activity (GO:0004519)

Curated
PM
AN modification du start, en accord avec usage du code, force du start et alignements autres xanthos
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 35304.6 Da
SQ 330 aa
 
........10........20........30........40........50
| | | | |
MPSWILAPLAALLLWLAVSAYLWLVRRRANEVHEGVRALAIMHWRDFSAV
VLRVLQDQRGWQPTQLPQDGLPTADFMMQTEHGTRLVACKHGRGYRIGVA
AVNELGAMARLAGANGGVMVTEGRMEREGIAAAEKQSIEVLDGVRLWPLL
KPYLPGDVEAGVVGAARRRAIRHSIIAGAALATLAVMAVLTLRPPAPTPA
TPRTAVSSPVPAPARVTAAATPSAGTAQPGPSPTAVPAAAPAPGAEPDAA
TIQGYQREVSKALAQTPGLVRGIWLTQATLVVDRTVEDSAAWPLICRELE
RHPYLRTVRVQLNPRPGTAEPVRWRQCSTI
XFF4834R

YP_363414.1 XCV1683

25

159

S=707 I=100 E=1.57397e-78

hypothetical protein

XFF4834R

YP_363414.1 XCV1683

251

330

S=412 I=98 E=7.02979e-43

hypothetical protein

XFF4834R

NP_636954.1 XCC1583

25

159

S=677 I=95 E=6.61733e-75

hypothetical protein

XFF4834R

NP_636954.1 XCC1583

251

330

S=378 I=88 E=1.15165e-38

hypothetical protein

XFF4834R

NP_641973.1 XAC1641-XAC1641

25

159

S=673 I=92 E=2.05555e-74

hypothetical protein

XFF4834R

NP_641973.1 XAC1641-XAC1641

251

330

S=410 I=98 E=1.17583e-42

hypothetical protein

XFF4834R

XALc_1712 XALc_1712

25

159

S=384 I=54 E=1.9448e-39

putative_membrane_protein_pd-(d/e)xk_nuclease_superfamily

XFF4834R

XALc_1712 XALc_1712

253

330

S=275 I=63 E=3.39065e-26

putative_membrane_protein_pd-(d/e)xk_nuclease_superfamily

Iprscan IPR007560 [PF04471]

75

146

Restriction endonuclease, type IV-like, Mrr

Iprscan [seg]

4

24

-

Iprscan [seg]

160

224

-

Iprscan [seg]

229

250

-

Iprscan [SignalP-NN(euk)]

1

20

-

Iprscan [tmhmm]

4

25

-

Iprscan [tmhmm]

170

192

-

PD607507

25

159

S=669 I=90 E=1.70863e-73

PD607507

251

330

S=408 I=95 E=6.26546e-42

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xljUOQre)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr28660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr28660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr28660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr28660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr36570333_3896512_r3_XFF4834R-XFF4834R_chr33750 XFF4834R_chr33750
XFF4834R_chr33740
XFF4834R_chr33740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr33770
XFF4834R_chr33770
ID XFF4834R_chr36570333_3896512_r3_XFF4834R-XFF4834R_chr33750
AC XFF4834R_chr33750
LT XFF4834R_chr33750
OR XFF4834R_chr from 3893333 to 3896512 on strand -
DE probable type I restriction-modification system endonuclease
IP Restriction endonuclease, type I, EcoRI, R subunit; Restriction endonuclease, type I, R subunit/Type III, Res subunit; Helicase, superfamily 1/2, ATP-binding domain;
CL 2.1.2 DNA restriction/modification GO:0006304 GO:0009307
EC
GO InterPro
Biological Process: DNA modification (GO:0006304)
Biological Process: DNA restriction-modification system (GO:0009307)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: Type I site-specific deoxyribonuclease activity (GO:0009035)
Molecular Function: endonuclease activity (GO:0004519)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [V] Defense mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100710)
MW 116789.5 Da
SQ 1059 aa
 
........10........20........30........40........50
| | | | |
MAFLSEAAVEQALLEQLRRLGYSVVSDNTAGPDGSAPERESHDVVVLQQR
LADAVTRLNPQLPPEAREDATRKLTQNELPNLLEENRRIHALLTEGVDVE
YYADDGVLTAGKVWLLDFDRPENNDWLAVQQFVVISGQTRRRPDVVLFVN
GLPLAVIELKSPGSAGANLVGAFNQLQTYKQQIPALFHTNAVLVTSDGIA
ARVGSLSADLERFMPWRTTDGRQVLPKGQPELPTLIEGVFAPQRFLELLR
WFTAFGETGGGLVKIIAGYHQFHAVNHAVESTIRASRSAVAEDPAKYGLA
SVKAQPAGDRRAGVIWHTQGSGKSLLMAFYAGRLVQHPAMRNPTLVVLTD
RNDLDDQLFGTFSMCKALLRQTPVQADSREDLAHLLDRASGGVIFTTLQK
FGELEAPLTTRRNVVVIADEAHRSQYGLKAKLDAETGVVSYGFAKYMRDA
LPNASFIGFTGTPIEATDVNTPALFGHYIDVYDISRAVEDGATVPIYYES
RLARIELDEDEKPHLDAEVEALFEGEGTDEKEKLKGRAAAVERLVGSQKR
LALVAQDLVTHFEERVAALDGKAMAVCMSREICVDLYTEIIKLRPHWHSD
DDTLGAVKIVMTGAASDPPHWQQHIGNKARRDALARRAKDPADPLKLVIV
RDMWLTGFDAPSMHTMYVDKPMKGHGLMQAIARVNRVFRDKPAGLIVDYI
GIAQNLKSALAQYSPQDKQNTGIDEAQAIAVLREKYEVVRDMYHGFDYLT
ALNGTPQQRLAMMAGAIEWILDQQQQWMAAASSDDGKKAAQRRYQDAVLA
LSTAYALASASDEALAVREEVGFFQAIREALVKSATGSGISSQERDFAIR
QIVSRAVVSTEIVDILKAAGIQSPDISILSDEFLAEVQRMEKKNLALEAL
RKLINDGIRSRSKRNIVETKAFSERLEDAIARYHANAITTAEVLQELIRI
AKDIRAARARGEEQGLSEDEIAFYDALAENESAVQVMGDDALKVIAHELL
VSLKGSASVDWARRDSARARMRVLVKRILRKYGYPPDLQDAAVRTVLQQA
EALSAAWSA
XFF4834R

NP_638253.1 lcl|XCC2905

44

722

S=539 I=29 E=1.0879e-57

HsdR protein

XFF4834R

NP_641505.1 lcl|XAC1169-XAC1169

1020

1059

S=196 I=98 E=4.35432e-16

hypothetical protein

XFF4834R

YP_362240.1 lcl|hsdR1-XCV0509

645

714

S=182 I=51 E=1.96618e-14

type I site-specific deoxyribonuclease (restriction subunit)

XFF4834R

YP_362240.1 lcl|hsdR1-XCV0509

313

490

S=152 I=33 E=8.63457e-11

type I site-specific deoxyribonuclease (restriction subunit)

XFF4834R

NP_635856.1 lcl|hsdR-XCC0462

645

714

S=173 I=49 E=2.88314e-13

type I restriction-modification system endonuclease

XFF4834R

NP_635856.1 lcl|hsdR-XCC0462

313

490

S=149 I=33 E=2.11958e-10

type I restriction-modification system endonuclease

XFF4834R

NP_643207.1 lcl|hsdR-XAC2898

144

713

S=137 I=25 E=5.77213e-09

type I restriction-modification system endonuclease

XFF4834R

YP_362925.1 lcl|hsdR2-XCV1194

646

713

S=115 I=31 E=2.5816e-06

type I site-specific deoxyribonuclease (restriction subunit)

XFF4834R

YP_362925.1 lcl|hsdR2-XCV1194

304

427

S=102 I=35 E=9.21205e-05

type I site-specific deoxyribonuclease (restriction subunit)

pubmed

3

1059

S=2389 I=47 E=0

Hsdr-like Type I restriction enzyme

Pubmed 12379698,15271940

 

prodomImg

pubmed

1

1054

S=2375 I=44 E=0

Type I restriction-modification system endonuclease Type I restriction-modification system endonuclease homologue

Pubmed 18926798,18086843

 

prodomImg

pubmed

1

1055

S=2366 I=44 E=0

Type I restriction-modification system endonuclease homologue

Pubmed 15215121

 

prodomImg

pubmed

43

1054

S=2183 I=43 E=0

HsdR

Pubmed 15699185

 

prodomImg

pubmed

43

1054

S=2181 I=43 E=0

HsdR

Pubmed 15699185

 

prodomImg

sp_Pdown

sp|O05052|T1RH_HAEIN

4

1054

S=1952 I=41 E=0

Putative type I restriction enzyme HindVIIP R protein EC=3.1.21.3 ; ATP-binding DNA-binding Hydrolase Nucleotide-binding system

sp_Pdown

sp|Q60295|T1RH_METJA

8

748

S=1119 I=36 E=1.91157e-126

Putative type-1 restriction enzyme MjaXP R protein EC=3.1.21.3 ; ATP-binding DNA-binding Hydrolase Nucleotide-binding Plasmid system

sp_Pdown

sp|Q60295|T1RH_METJA

813

1033

S=330 I=32 E=8.04983e-31

Putative type-1 restriction enzyme MjaXP R protein EC=3.1.21.3 ; ATP-binding DNA-binding Hydrolase Nucleotide-binding Plasmid system

sp_Pdown

sp|Q57588|Y124_METJA

411

714

S=310 I=31 E=1.8722e-28

Uncharacterized protein MJ0124

sp_Pdown

sp|Q58611|Y1214_METJA

109

714

S=308 I=24 E=3.8604e-28

Uncharacterized protein MJ1214

Iprscan IPR021810 [PF11867]

716

1058

Protein of unknown function DUF3387

Iprscan IPR007409 [PF04313]

4

211

Restriction endonuclease, type I, EcoRI, R subunit/Type III, Res subunit, N-terminal

Iprscan IPR006935 [PF04851]

285

464

Restriction endonuclease, type I, R subunit/Type III, Res subunit

Iprscan IPR014001 [SM00487]

263

497

DEAD-like helicase, N-terminal

Iprscan IPR004473 [TIGR00348]

6

719

Restriction endonuclease, type I, EcoRI, R subunit

Iprscan IPR014021 [PS51192]

304

481

Helicase, superfamily 1/2, ATP-binding domain

Iprscan [seg]

628

644

-

Iprscan [seg]

779

790

-

Iprscan [seg]

797

811

-

Iprscan [seg]

948

960

-

PDA1O2N2

729

796

S=257 I=69 E=1.82331e-23

PD003073

645

691

S=213 I=79 E=3.84313e-18

PD023057

1

108

S=192 I=51 E=1.38222e-15

PD003184

305

365

S=188 I=57 E=4.52419e-15

PD537486

871

928

S=187 I=64 E=5.87674e-15

PD779586

574

616

S=186 I=74 E=7.11933e-15

PDA82113

362

404

S=174 I=79 E=2.47484e-13

PDA1G587

812

870

S=162 I=58 E=6.07008e-12

PDA0T8Y4

232

286

S=156 I=61 E=3.09935e-11

PD392155

453

505

S=150 I=55 E=1.77244e-10

Iprscan [SSF52540]

311

480

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one yxSq8En1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

50 hits
swiss-prot

Swiss-Prot ncbi-blastp

18 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr33750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr33750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr33750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr33750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4951849_4952112_f1_XFF4834R-XFF4834R_chr42740 XFF4834R_chr42740
XFF4834R_chr42730
XFF4834R_chr42730
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42750
XFF4834R_chr42750
ID XFF4834R_chr_4951849_4952112_f1_XFF4834R-XFF4834R_chr42740
AC XFF4834R_chr42740
LT XFF4834R_chr42740
OR XFF4834R_chr from 4951849 to 4952112 on strand +
DE putative Type-2 restriction endonuclease BsuBI/PstI
IP Restriction endonuclease, type II, BsuBI/PstI, C-terminal
CL 2.1.2 DNA restriction/modification GO:0006304 GO:0009307
EC
GO InterPro
Biological Process: DNA restriction-modification system (GO:0009307)
Molecular Function: Type II site-specific deoxyribonuclease activity (GO:0009036)
Molecular Function: magnesium ion binding (GO:0000287)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100920)
MW 9966.2 Da
SQ 87 aa
 
........10........20........30........40........50
| | | | |
MFIWNWLLLGESVTSHGRGDSKRHAELARAGPSWADTLAKSPWETEVWVA
DAPSHLIHFNDVRFLVPYPERTSGARRLHSFRLIVKS
Show or not Domain decomposition
 
pubmed

5

70

S=189 I=59 E=3.06175e-15

Type II restriction enzyme BsuBI ; Plasmid

Pubmed 16165318

 

prodomImg

pubmed

6

68

S=184 I=59 E=1.31316e-14

Type-2 restriction enzyme BsuBI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Pubmed 1480472

 

prodomImg

pubmed

5

68

S=158 I=49 E=2.07928e-11

Methyltransferase-endonuclease

Pubmed 12620628

 

prodomImg

pubmed

6

71

S=116 I=40 E=2.50843e-06

Type-2 restriction enzyme PstI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Pubmed 6330092

 

prodomImg

sp_Pdown

sp|P33562|T2BB_BACSU

6

68

S=184 I=59 E=8.65583e-15

Type-2 restriction enzyme BsuBI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

sp_Pdown

sp|P00640|T2PS_PROST

6

71

S=116 I=40 E=1.65347e-06

Type-2 restriction enzyme PstI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Iprscan IPR009528 [PF06616]

43

69

Restriction endonuclease, type II, BsuBI/PstI, C-terminal

PD024524

6

68

S=132 I=45 E=1.61175e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4KDb1mqr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr42740.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr42740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr42740.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_chr42740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plc00240
XFF4834R_plc00230
XFF4834R_plc00230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc_0025
XFF4834R_plc_0025
ID
AC XFF4834R_plc00240
LT XFF4834R_plc00240
OR XFF4834R_plc from 18106 to 19107 on strand +
DE Probable Type II restriction endonuclease XcyI
IP Restriction endonuclease, type II, XcyI
CL 2.1.2 DNA restriction/modification GO:0006304 GO:0009307
EC
GO InterPro
Biological Process: DNA restriction-modification system (GO:0009307)
Molecular Function: Type II site-specific deoxyribonuclease activity (GO:0009036)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: magnesium ion binding (GO:0000287)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 36765.7 Da
SQ 333 aa
 
........10........20........30........40........50
| | | | |
MTTPNKINFPPPKLQIDFAFALKRFRAVYLQSALLETVRDMDIAELDRQL
SKYVPPADLATLAQYGLRAELLFAVPAVLEANPHLLGYYRLLMGYSQKEF
YGRDKGFGVGCFKSMEEKGKAGKAAVADLHDLCVAFCAAASALLAGVGPL
RVSRELLDDLTLLTVGPQLRGGANNQRGADGIVLVFEIIREIVAHAAAEV
RESAIEVNSATGRPVLIEFAPDPDIIIREEMEHQHYRNVVAIEVKSGTDV
SNIHNRIGEAEKSHQKARQRGFTECWTVVNVGRLDMVKARSESPSTDRFY
SLTALSLRAGDEYDDFRRRVLSLTAIPARPANP
Show or not Domain decomposition
 
pubmed

1

333

S=1546 I=92 E=1.15447e-178

Probable restriction endonuclease R.XmaI ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

1

333

S=1532 I=91 E=6.09879e-177

Type-2 restriction enzyme XcyI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Pubmed 1475187

 

prodomImg

pubmed

1

333

S=1482 I=88 E=6.79661e-171

Pac25I endonuclease ; Plasmid

Pubmed 9742696,9465390

 

prodomImg

pubmed

5

330

S=1225 I=75 E=9.80487e-140

Type-2 restriction enzyme Cfr9I EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Pubmed 8163180

 

prodomImg

sp_Pdown

sp|P30773|T2X1_XANCC

1

333

S=1532 I=91 E=4.20085e-177

Type-2 restriction enzyme XcyI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

sp_Pdown

sp|Q60132|T2C9_CITFR

5

330

S=1225 I=75 E=6.7536e-140

Type-2 restriction enzyme Cfr9I EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Iprscan IPR019071 [PF09571]

10

327

Restriction endonuclease, type II, XcyI

Iprscan [seg]

116

125

-

Iprscan [seg]

133

148

-

PDA1S0B1

149

327

S=664 I=76 E=5.80968e-73

PD017942

10

114

S=498 I=90 E=9.0695e-53

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nWK1yp7k)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00240.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00240.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_plc_0036603_0037172_f3_XFF4834R-XFF4834R_plc00430 XFF4834R_plc00430
XFF4834R_plc00430
XFF4834R_plc00430
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc_0044
XFF4834R_plc_0044
ID XFF4834R_plc_0036603_0037172_f3_XFF4834R-XFF4834R_plc00430
AC XFF4834R_plc00430
LT XFF4834R_plc00430
OR XFF4834R_plc from 35603 to 36172 on strand +
DE putative restriction endonuclease protein
IP Restriction endonuclease, type IV-like, Mrr
CL 2.1.2 DNA restriction/modification GO:0006304 GO:0009307
EC
GO InterPro
Biological Process: DNA restriction-modification system (GO:0009307)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: endonuclease activity (GO:0004519)

Curated
PM
AN
CC COG: [V] Defense mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100713)
MW 21509.6 Da
SQ 189 aa
 
........10........20........30........40........50
| | | | |
MSWSQLFALFVGLAILAALAVVSALRPKARERRHRRRQDQARRVLAKINT
IPLMPQRLAYLRKIDPLTFEELLLETFERRGYRVERNTHYTGDGGVDGAV
YLNGTRYLLQAKRYRKHINRAHILAFAELLEARGSRGIFIHTGRTGAGAR
ELATANPHLTIISGQRLLDFLNSGRLDRENANAHRTMGN
Show or not Domain decomposition
 
XFF4834R

lcl|XALq_3201

44

188

S=608 I=81 E=6.41949e-67

putative restriction endonuclease protein

pubmed

44

174

S=332 I=48 E=6.29874e-32

Restriction endonuclease family ; Plasmid

Pubmed 19258268

 

prodomImg

pubmed

44

174

S=332 I=48 E=6.75377e-32

Putative uncharacterized protein

Pubmed 8029323,7891554

 

prodomImg

pubmed

44

174

S=332 I=48 E=6.75377e-32

Putative uncharacterized protein

Pubmed 8029323,7891554

 

prodomImg

pubmed

44

174

S=332 I=48 E=6.75377e-32

Putative uncharacterized protein ; Plasmid

Pubmed 15963296,16027145

 

prodomImg

pubmed

44

174

S=332 I=48 E=7.30507e-32

Restriction endonuclease family ; Plasmid

Pubmed 19258268

 

prodomImg

Iprscan IPR007560 [PF04471]

74

167

Restriction endonuclease, type IV-like, Mrr

Iprscan [seg]

6

25

-

Iprscan [seg]

26

43

-

Iprscan [seg]

67

78

-

Iprscan [SignalP-NN(euk)]

1

24

-

Iprscan [tmhmm]

5

27

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one shp8iN43)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00430.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00430.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2mV7kS/XFF4834R_plc00430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.