Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr17800XFF4834R_chr18980161_2036045_f3_XFF4834R-XFF4834R_chr17800XFF4834R_chr17800putative Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  2. XFF4834R_chr20060carAXFF4834R_chr20060carbamoyl phosphate synthase small subunit
  3. XFF4834R_chr20080carBXFF4834R_chr20080Carbamoyl phosphate synthase large subunit
  4. XFF4834R_chr23070XFF4834R_chr25200183_2671109_f3_XFF4834R-XFF4834R_chr23070XFF4834R_chr23070putative carbon-nitrogen hydrolase
  5. XFF4834R_chr23250XFF4834R_chr25420936_2693739_r1_XFF4834R-XFF4834R_chr23250XFF4834R_chr23250hypothetical carbon-nitrogen hydrolase

XFF4834R_chr18980161_2036045_f3_XFF4834R-XFF4834R_chr17800 XFF4834R_chr17800
XFF4834R_chr17790
XFF4834R_chr17790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17810
XFF4834R_chr17810
ID XFF4834R_chr18980161_2036045_f3_XFF4834R-XFF4834R_chr17800
AC XFF4834R_chr17800
LT XFF4834R_chr17800
OR XFF4834R_chr from 2035161 to 2036045 on strand +
DE putative Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
IP Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
CL 1.8.3 Nitrogen metabolism GO:0006807
EC
GO InterPro
Biological Process: nitrogen compound metabolic process (GO:0006807)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 31268.3 Da
SQ 294 aa
 
........10........20........30........40........50
| | | | |
MKIAVAKYPIGKPVDFAAFAARQSALIAEAAAAGARVVVLPEYLSLELGA
TFDTPISAGLPESLAAIQALRAPWLELFAGLAQEHRLHLIAGSFLLDIGH
GRYRNRSDWFTPEGLHGWQDKLQLTGFEKATGLIEPGDAVKVFELDGIRA
AIAICYDSEFPLPVRAQYEAGARLLIVPSCTDTAAGAMRVRVGCLARALE
NRVFVAQSVTAGDAPWSPALDINTGEAAVFAPMDVGFPADGVLAQTQGQT
VWALAELDFAAFEASRAQAQVANDRDWPGQLAPDVTRAKLVAFG
XFF4834R

NP_643158.1 lcl|nthA-XAC2849

1

294

S=1322 I=88 E=3.43589e-153

nitrilase

XFF4834R

YP_364740.1 lcl|XCV3009

1

294

S=1298 I=86 E=3.2811e-150

carbon-nitrogen hydrolase family protein

XFF4834R

NP_638036.1 lcl|nthA-XCC2688

1

293

S=1227 I=81 E=1.0668e-141

nitrilase

pubmed

1

247

S=310 I=30 E=6.4965e-29

UPF0012 hydrolase yhcX EC=3.5.-.-

Pubmed 8969498

 

prodomImg

pubmed

38

190

S=158 I=31 E=1.29676e-10

IdhX protein

Pubmed 8626059

 

prodomImg

pubmed

97

213

S=137 I=34 E=5.65005e-08

(R)-stereoselective amidase R-stereospecific amidase

Pubmed 15066183,15955066

 

prodomImg

pubmed

62

233

S=130 I=32 E=3.25942e-07

Predicted amidohydrolase ; Plasmid

Pubmed 18241920

 

prodomImg

pubmed

81

217

S=127 I=27 E=8.35762e-07

Nitrilase-like protein

Pubmed 17469070

 

prodomImg

pubmed

76

215

S=125 I=30 E=1.63547e-06

Putative amidohydrolase

Pubmed 17322329

 

prodomImg

pubmed

36

213

S=120 I=24 E=6.5418e-06

Nitrilase homolog 2 EC=3.5.-.- ; Cytoplasm Hydrolase

Pubmed 15520368

 

prodomImg

pubmed

78

213

S=116 I=26 E=1.78298e-05

Nitrilase homolog 2 EC=3.5.-.- ; Cytoplasm Hydrolase Phosphoprotein

Pubmed 10959838

 

prodomImg

pubmed

36

213

S=115 I=25 E=2.10421e-05

Nitrilase homolog 2 EC=3.5.-.- ; Cytoplasm Hydrolase Phosphoprotein Polymorphism

Pubmed 10959838

 

prodomImg

sp_Pdown

sp|P54608|YHCX_BACSU

1

247

S=310 I=30 E=4.47746e-29

UPF0012 hydrolase yhcX EC=3.5.-.-

sp_Pdown

sp|Q6INI7|NIT2B_XENLA

76

213

S=133 I=28 E=1.13801e-07

Nitrilase homolog 2-B EC=3.5.-.- ; Cytoplasm Hydrolase

sp_Pdown

sp|Q6IR61|NIT2A_XENLA

36

213

S=128 I=27 E=3.89082e-07

Nitrilase homolog 2-A EC=3.5.-.- ; Cytoplasm Hydrolase

sp_Pdown

sp|Q10166|YAUB_SCHPO

36

213

S=128 I=25 E=4.83843e-07

UPF0012 hydrolase C26A3.11 EC=3.5.-.-

sp_Pdown

sp|Q28IE5|NIT2_XENTR

76

213

S=125 I=28 E=1.1077e-06

Nitrilase homolog 2 EC=3.5.-.- ; Cytoplasm Hydrolase

Iprscan IPR003010 [G3DSA:3.60.110.10]

1

275

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan IPR003010 [PF00795]

26

180

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan IPR003010 [PS50263]

1

283

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan [seg]

20

35

-

Iprscan [seg]

253

264

-

PD609926

1

60

S=189 I=67 E=1.95943e-15

PD391339

212

281

S=132 I=41 E=1.78536e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one syRO8PeB)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr17800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr17800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr17800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr17800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
carA XFF4834R_chr20060
XFF4834R_chr20050
XFF4834R_chr20050
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20070
XFF4834R_chr20070
ID carA
AC XFF4834R_chr20060
LT XFF4834R_chr20060
OR XFF4834R_chr from 2298654 to 2299829 on strand +
DE carbamoyl phosphate synthase small subunit
IP Glutamine amidotransferase class-I, C-terminal; Carbamoyl phosphate synthase, GATase region; Carbamoyl phosphate synthase, small subunit
CL 1.8.3 Nitrogen metabolism GO:0006807
EC
GO InterPro
Biological Process: nitrogen compound metabolic process (GO:0006807)
Biological Process: glutamine metabolic process (GO:0006541)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086)

Curated
PM
AN
CC COG: [EF] Amino acid transport and metabolism;Nucleotide transport and metabolism;
CC MODEL: acur
CC STATUS: curated by darrasse (20130514)
MW 41624 Da
SQ 391 aa
 
........10........20........30........40........50
| | | | |
MTQPAILVLEDGTVFEGESVGANGLSVGEVVFNTAMTGYQEVLTDPSYAR
QMVTLTYPHIGNTGFTDQDDEARKIWAAGLIVRDVPRRPSNWRSQVALPE
WLQARGVVAISGIDTRKLTRLLRQKGAQNGALMAGDIDVEKALEAARKFP
GLKGMDLAKVVSTESTYTWKEGSLDLNSDSFLGLGALHIGKSAHGSAGSG
EGLAFKVVAYDYGVKLNILRMLAERGCDVTVVPARTPVAEVLALQPDGVF
LSNGPGDPEPCDYAIDAIKELIAQKVPTFGICLGHQLLALAAGAKTLKMT
TGHHGANHPVQDLDGGRVMITSQNHGFAVDESTLPANVRVTHRSLFDGTN
QGIALTDAPAFSFQGHPEASPGPRDVGPLFDRFVDLMAARA
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JELsfXPM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

634 hits
swiss-prot

Swiss-Prot ncbi-blastp

268 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20060.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20060.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
carB XFF4834R_chr20080
XFF4834R_chr20070
XFF4834R_chr20070
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20090
XFF4834R_chr20090
ID carB
AC XFF4834R_chr20080
LT XFF4834R_chr20080
OR XFF4834R_chr from 2300281 to 2303523 on strand +
DE Carbamoyl phosphate synthase large subunit
IP Carbamoyl phosphate synthetase, large subunit, ATP-binding; Carbamoyl phosphate synthetase, large subunit, oligomerisation; MGS-like; Phosphoribosylaminoimidazole carboxylase
CL 1.8.3 Nitrogen metabolism GO:0006807
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: nitrogen compound metabolic process (GO:0006807)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [EF] Amino acid transport and metabolism;Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 117426.1 Da
SQ 1080 aa
 
........10........20........30........40........50
| | | | |
MPKRTDLKTILIIGAGPIVIGQACEFDYSGAQACKALRDEGYRVVLVNSN
PATIMTDPNMADAVYIEPINWQTVEKIIAKEKPDALLPTMGGQTALNCAL
DLADHGVLEKYNVELIGAKREAIRMAEDRELFRVAMGEIGLDCPTAAVAH
TLEEALEIQTRVGYPTIIRPSFTLAGSGGGIAYNREELIEIVGRGLELSP
TTEVLVEESVLGWKEFEMEVVRDTADNCIIVCAIENLDPMGVHTGDSITV
APAQTLTDKEYQRLRDASIAVLRKIGVDTGGSNVQFGISPTTGRVVVIEM
NPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELKNEITGGLTPASFEP
SIDYVVTKIPRFAFEKFPQADARLTTQMKSVGEVMAMGRTFQESLQKALR
GLETGKIGLDPTGLDLNSEDDIATLKRELKAPGPERLFYVADAFRAGMTV
ADVYALSFIDPWFLDQIEEIISHEQQLADDGMAALNAPRLRMLKRAGFSD
ARMAQLIGSNEESVRTLRRALKVRPVYKRVDSCAAEFGTSTAYLYSTYED
ECEALPTDRDKIMILGGGPNRIGQGIEFDYCCVHAALALRDDGFETIMVN
CNPETVSTDYDTSDRLYFEPLTLEDVLEIVELEKPKGVIVQYGGQTPLKL
ARALEANGVPVIGTSPDSIDLAEDRERFQQLVDKLGLKQPPNRIARNAEE
ALVLAREIGYPLVVRPSYVLGGRAMEIVYGESDLARYVRDAVKVSNDSPV
LLDRFLDNAVEVDVDIIADKDGNVLIGGVMEHIEEAGVHSGDSSCSLPPY
SLSPQTQAELRRQVVMLAEGLNVVGLMNTQFAVQVNEAGDDIVYLLEVNP
RASRTVPFVSKAIGMPLAKIAARCMAGKTLAEQGATKEIVPDYYSVKEAI
FPFAKFQGVDPILGPEMRSTGEVMGVGRSFSAAFARAQEAGGIKAPPLGK
AFVSVRDPDKQRVLPVAQALVERGFTLVATRGTGAWLQQNGLSCEIVNKV
AEGRPHIVDSIKNGEIVYIVNTTEGRAAISDSFSIRREALQHRVTYSTTV
AGAKALVQSLEFRGTGPVWSLQELHKELEA
XFF4834R

XFF4834R_chr05280 lcl|accC-XFF4834R_chr05280

650

775

S=103 I=27 E=2.29902e-05

acetyl-CoA carboxylase, biotin carboxylase subunit

XFF4834R

XFF4834R_chr05280 lcl|accC-XFF4834R_chr05280

650

775

S=103 I=27 E=2.29902e-05

acetyl-CoA carboxylase, biotin carboxylase subunit

pubmed

1

1080

S=3951 I=69 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nu

Pubmed 9139926

 

prodomImg

pubmed

1

1079

S=3937 I=69 E=0

ADP-forming, carbamate-phosphorylating EC=6.3.5.5 ; Ligase

Pubmed 10675618

 

prodomImg

pubmed

1

1075

S=3910 I=69 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide

Pubmed 12768451

 

prodomImg

pubmed

1

1079

S=3900 I=69 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nu

Pubmed 2843375

 

prodomImg

pubmed

1

1079

S=3889 I=69 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Manganese Metal-binding Nucleotide-bin

Pubmed 6308632,6377309

 

prodomImg

pubmed

1

1080

S=3885 I=69 E=0

Carbamoyl-phosphate synthase large subunit ; Magnesium Manganese Metal-binding Pyrimidine biosynthesis

Pubmed 18257682

 

prodomImg

pubmed

1

1079

S=3738 I=66 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide-

Pubmed 7773412

 

prodomImg

pubmed

1

1061

S=3489 I=63 E=0

Putative uncharacterized protein ; Magnesium Manganese Metal-binding Pyrimidine biosynthesis

Pubmed 16041144

 

prodomImg

pubmed

3

1061

S=3223 I=59 E=0

Putative carbamoyl phosphate synthase large subunit

Pubmed 16024685

 

prodomImg

pubmed

1

1080

S=2960 I=55 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide

Pubmed 17194220

 

prodomImg

sp_Pdown

sp|P58942|CARB_XANAC

1

1080

S=5598 I=98 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide

sp_Pdown

sp|P58943|CARB_XANCP

1

1080

S=5494 I=96 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide

sp_Pdown

sp|Q87EB8|CARB_XYLFT

1

1079

S=4877 I=86 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide

sp_Pdown

sp|Q9PEC1|CARB_XYLFA

1

1079

S=4832 I=86 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide

sp_Pdown

sp|Q87WP4|CARB_PSESM

1

1080

S=4016 I=70 E=0

Carbamoyl-phosphate synthase large chain EC=6.3.5.5 ; Amino-acid biosynthesis Arginine ATP-binding Ligase Magnesium Manganese Metal-binding Nucleotide

Iprscan IPR005483 [PR00098]

19

33

Carbamoyl phosphate synthase, large subunit

Iprscan IPR005483 [PR00098]

48

58

Carbamoyl phosphate synthase, large subunit

Iprscan IPR005483 [PR00098]

168

180

Carbamoyl phosphate synthase, large subunit

Iprscan IPR005483 [PR00098]

204

223

Carbamoyl phosphate synthase, large subunit

Iprscan IPR005483 [PR00098]

239

256

Carbamoyl phosphate synthase, large subunit

Iprscan IPR005483 [PR00098]

297

326

Carbamoyl phosphate synthase, large subunit

Iprscan IPR005483 [PR00098]

380

398

Carbamoyl phosphate synthase, large subunit

Iprscan IPR013817 [G3DSA:3.40.50.20]

1

116

Pre-ATP-grasp fold

Iprscan IPR013816 [G3DSA:3.30.470.20]

187

403

ATP-grasp fold, subdomain 2

Iprscan [G3DSA:1.10.1030.10]

405

554

-

Iprscan IPR013817 [G3DSA:3.40.50.20]

553

659

Pre-ATP-grasp fold

Iprscan IPR013816 [G3DSA:3.30.470.20]

733

942

ATP-grasp fold, subdomain 2

Iprscan [G3DSA:3.40.50.1380]

943

1079

-

Iprscan [PTHR11405]

1

1061

-

Iprscan IPR005479 [PF02786]

128

334

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR005479 [PF02786]

674

882

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR005481 [PF00289]

7

123

Carbamoyl phosphate synthase, large subunit, N-terminal

Iprscan IPR005481 [PF00289]

560

669

Carbamoyl phosphate synthase, large subunit, N-terminal

Iprscan IPR005480 [PF02787]

426

548

Carbamoyl phosphate synthetase, large subunit, oligomerisation

Iprscan IPR011607 [PF02142]

963

1048

MGS-like

Iprscan IPR011607 [SM00851]

962

1048

MGS-like

Iprscan IPR006275 [TIGR01369]

2

1060

Carbamoyl phosphate synthase, large subunit, glutamine-dependent

Iprscan [seg]

793

804

-

Iprscan [SignalP-NN(euk)]

1

21

-

PD001652

414

548

S=336 I=49 E=6.04133e-33

PD111324

234

325

S=281 I=57 E=2.60069e-26

PD111324

780

873

S=238 I=56 E=4.14713e-21

PD002195

950

1079

S=279 I=45 E=3.98683e-26

PDA0W2V9

317

602

S=275 I=25 E=1.33953e-25

PD757669

713

779

S=227 I=68 E=8.32348e-20

PDA879S0

53

126

S=212 I=64 E=6.50965e-18

PD000704

53

123

S=204 I=56 E=4.79366e-17

PD000704

604

670

S=203 I=59 E=7.03515e-17

PD719820

220

366

S=198 I=34 E=3.32102e-16

PDA1F6Q8

326

373

S=192 I=77 E=1.63758e-15

PDA1F7V3

875

912

S=161 I=79 E=8.5615e-12

Iprscan [SSF56059]

128

402

-

Iprscan [SSF56059]

674

940

-

Iprscan IPR016185 [SSF52440]

556

676

PreATP-grasp-like fold

Iprscan IPR016185 [SSF52440]

1

127

PreATP-grasp-like fold

Iprscan IPR005480 [SSF48108]

396

556

Carbamoyl phosphate synthetase, large subunit, oligomerisation

Iprscan [SSF52335]

942

1079

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KkN5t6h6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

30 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20080.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20080.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr20080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr25200183_2671109_f3_XFF4834R-XFF4834R_chr23070 XFF4834R_chr23070
XFF4834R_chr23060
XFF4834R_chr23060
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23080
XFF4834R_chr23080
ID XFF4834R_chr25200183_2671109_f3_XFF4834R-XFF4834R_chr23070
AC XFF4834R_chr23070
LT XFF4834R_chr23070
OR XFF4834R_chr from 2670225 to 2671109 on strand +
DE putative carbon-nitrogen hydrolase
IP Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
CL 1.8.3 Nitrogen metabolism GO:0006807
EC
GO InterPro
Biological Process: nitrogen compound metabolic process (GO:0006807)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)

Curated
PM
AN This family contains nitrilases that break carbon-nitrogen bonds and appear to be involved in the reduction of organic nitrogen compounds and ammonia production. They all have distinct substrate specificity and include cyanide hydratases, aliphatic amidases, beta-alanine synthase, and a few other proteins with unknown molecular function. Sequence conservation over the entire length, as well as the similarity in the reactions catalyzed by the known enzymes in this family, points to a common catalytic mechanism. They have an invariant cysteine that is part of the catalytic site in nitrilases. Another highly conserved motif includes an invariant glutamic acid that might also be involved in catalysis.
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 32682.8 Da
SQ 294 aa
 
........10........20........30........40........50
| | | | |
MTRHLLPVALIQERNHGDAEANLAVIASRVAEAAAQGAKLVLLQELHNGA
YFCQHESVDEFNLAEPIPGPSTERLSALAKQHGVVLVASLFERRAAGLYH
NTAVVFEKDGRLLGKYRKMHIPDDPGFYEKFYFTPGDLGFTPIDTSVGRL
GVLVCWDQWYPEAARLMALAGAELLLCPTAIGWDPDDQQPEQERQRDAWI
LSHRGHAVANGVPVLSCNRVGYEPSPLGASGIQFWGNSHVLGPQGEFIAE
AGQDPTVLICDVDLQRSEHVRRIWPFLRDRRIDAYGDLLKRYID
XFF4834R

XFF4834R_chr14070 nadE-XFF4834R_chr14070

79

180

S=143 I=36.89 E=7.17196e-11

putative glutamine-dependent NAD(+) synthetase

XFF4834R

XFF4834R

YP_364232.1 XCV2501

1

294

S=1393 I=90.48 E=1.01168e-161

putative carbon-nitrogen hyrolase family protein

xanc5

XFF4834R

NP_642620.1 XAC2303-XAC2303

1

294

S=1391 I=90.48 E=1.66293e-161

beta-alanine synthetase

xanac

XFF4834R

NP_637555.1 XCC2199

1

294

S=1355 I=86.73 E=3.3878e-157

beta-alanine synthetase

xancp

XFF4834R

XALc_1607 XALc_1607

1

294

S=1320 I=84.35 E=5.59866e-153

putative carbon-nitrogen hydrolase family protein.

xanal

XFF4834R

XALc_0688 XALc_0688

37

180

S=149 I=33.1 E=5.61817e-11

putative nad(+) synthase (glutamine-hydrolyzing) protein

xanal

XFF4834R

NP_643528.1 nadE-XAC3220

79

180

S=135 I=35.92 E=2.18739e-09

NAD synthetase

xanac

XFF4834R

YP_365076.1 nadE-XCV3345

79

180

S=132 I=34.95 E=5.41656e-09

NAD synthetase

xanc5

XFF4834R

NP_638438.1 nadE-XCC3091

79

180

S=127 I=33.98 E=2.46931e-08

NAD synthetase

xancp

pubmed

5

289

S=553 I=41.87 E=2.7085e-58

N-carbamoylputrescine amidase EC=3.5.1.53 ; Hydrolase Polyamine biosynthesis

Pubmed 12435743

 

prodomImg

pubmed

6

290

S=502 I=37.09 E=4.05992e-52

B-alanine synthase

Pubmed 12670488

 

prodomImg

pubmed

36

293

S=495 I=39.23 E=2.76407e-51

Amidohydrolase

Pubmed 16436438

 

prodomImg

pubmed

6

290

S=363 I=32.76 E=2.58837e-35

Putative N-carbamoylputrescine amidohydrolase

Pubmed 18256468

 

prodomImg

pubmed

8

291

S=329 I=32.53 E=3.75315e-31

Omega-amidase NIT2 EC=3.5.1.3 ; Cytoplasm Hydrolase Phosphoprotein Polymorphism Reference proteome

Pubmed 10959838

 

prodomImg

sp_Pdown

sp|Q9XGI9|AGUB_SOLLC

5

289

S=553 I=41.87 E=1.63195e-58

N-carbamoylputrescine amidase EC=3.5.1.53 ; Hydrolase Polyamine biosynthesis

sp_Pdown

sp|Q3HVN1|AGUB_SOLTU

5

289

S=546 I=41.87 E=1.17073e-57

N-carbamoylputrescine amidase EC=3.5.1.53 ; Hydrolase Polyamine biosynthesis

sp_Pdown

sp|Q8VYF5|AGUB_ARATH

36

289

S=536 I=44.19 E=1.71673e-56

N-carbamoylputrescine amidase EC=3.5.1.53 ; Alternative splicing Hydrolase Polyamine biosynthesis Reference proteome

sp_Pdown

sp|Q93XI4|AGUB_ORYSJ

36

289

S=529 I=44.19 E=1.30905e-55

N-carbamoylputrescine amidase EC=3.5.1.53 ; Hydrolase Polyamine biosynthesis

sp_Pdown

sp|Q9NQR4|NIT2_HUMAN

8

291

S=329 I=32.53 E=2.26139e-31

Omega-amidase NIT2 EC=3.5.1.3 ; Cytoplasm Hydrolase Phosphoprotein Polymorphism Reference proteome

Iprscan IPR003010 [G3DSA:3.60.110.10]

8

290

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan [PTHR23088]

8

293

-

Iprscan IPR003010 [PF00795]

9

180

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan IPR003010 [PS50263]

6

286

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan [seg]

24

35

-

Iprscan [seg]

184

197

-

PD052217

64

281

S=268 I=35.44 E=5.4324e-25

PD859894

198

245

S=183 I=73.47 E=1.07275e-14

PD840823

258

294

S=172 I=81.08 E=2.70088e-13

PD874991

14

67

S=142 I=55.56 E=1.20697e-09

PD552254

75

179

S=128 I=36.67 E=4.86603e-08

PDA24380

199

290

S=113 I=26.88 E=3.7726e-06

PD736133

99

286

S=109 I=25.56 E=1.10251e-05

PD789729

67

157

S=104 I=31.25 E=3.90323e-05

Iprscan IPR003010 [SSF56317]

3

291

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2sh8By1k)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

163 hits
swiss-prot

Swiss-Prot ncbi-blastp

80 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23070.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23070.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr25420936_2693739_r1_XFF4834R-XFF4834R_chr23250 XFF4834R_chr23250
XFF4834R_chr23240
XFF4834R_chr23240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23260
XFF4834R_chr23260
ID XFF4834R_chr25420936_2693739_r1_XFF4834R-XFF4834R_chr23250
AC XFF4834R_chr23250
LT XFF4834R_chr23250
OR XFF4834R_chr from 2692936 to 2693739 on strand -
DE hypothetical carbon-nitrogen hydrolase
IP Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
CL 1.8.3 Nitrogen metabolism GO:0006807
EC
GO InterPro
Biological Process: nitrogen compound metabolic process (GO:0006807)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 30216.9 Da
SQ 267 aa
 
........10........20........30........40........50
| | | | |
MNDLRISLIQGDTRWHDPAGNRDYYAALLEPLVGRTDLVILPETFTSGFS
NDAIDKAEGMDGPTVAWVRAQAARLGAVVTGSVQLRTDAGVFNRLLWATP
DGALQYYDKRHLFRFGNEHLRYAAGRERLTVEWKGWRINPQVCYDLRFPV
FCRNRFDVERPGQLDFDLQLFVANWPSARAYAWKTLLRARAIENLCFVAA
VNRIGIDGNQLHYAGDSAVIDFLGQPQVEIREREQVVTTTISATALAEHR
ARFPAMLDADRFEIGDS
Show or not Domain decomposition
 
XFF4834R

YP_364251.1 lcl|XCV2520

1

266

S=1385 I=98 E=6.99878e-161

carbon-nitrogen hydrolase family protein

XFF4834R

NP_642638.1 lcl|XAC2321-XAC2321

1

266

S=1359 I=97 E=1.07959e-157

hydrolase

XFF4834R

NP_637573.1 lcl|XCC2217

1

266

S=1308 I=91 E=1.44486e-151

hydrolase

XFF4834R

lcl|XALc_1300

2

265

S=1214 I=85 E=4.25744e-140

putative carbon-nitrogen hydrolase protein

pubmed

6

258

S=319 I=33 E=3.67014e-30

UPF0012 hydrolase mtnU EC=3.5.-.-

Pubmed 12022921

 

prodomImg

pubmed

4

258

S=310 I=33 E=5.4289e-29

Putative amidohydrolase

Pubmed 17322329

 

prodomImg

pubmed

4

255

S=262 I=29 E=3.22948e-23

UPF0012 hydrolase in agr operon EC=3.5.-.-

Pubmed 7565609

 

prodomImg

pubmed

36

255

S=255 I=31 E=2.42e-22

UPF0012 hydrolase in agr operon

Pubmed 8359673

 

prodomImg

pubmed

55

256

S=239 I=31 E=1.85992e-20

Putative C-N hydrolase

Pubmed 16321935

 

prodomImg

pubmed

55

256

S=237 I=31 E=3.63961e-20

Putative C-N hydrolase

Pubmed 16321935

 

prodomImg

pubmed

55

256

S=236 I=31 E=4.40919e-20

Putative C-N hydrolase

Pubmed 16321935

 

prodomImg

pubmed

55

256

S=236 I=31 E=4.76911e-20

Putative C-N hydrolase

Pubmed 16321935

 

prodomImg

pubmed

55

256

S=235 I=31 E=5.67763e-20

Putative C-N hydrolase

Pubmed 16321935

 

prodomImg

pubmed

55

256

S=235 I=31 E=5.67763e-20

Putative C-N hydrolase

Pubmed 16321935

 

prodomImg

sp_Pdown

sp|Q47679|YAFV_ECOLI

1

264

S=576 I=45 E=2.21993e-61

UPF0012 hydrolase yafV EC=3.5.-.-

sp_Pdown

sp|O31664|MTNU_BACSU

6

258

S=319 I=33 E=2.53077e-30

UPF0012 hydrolase mtnU EC=3.5.-.-

sp_Pdown

sp|P55177|YAG5_STAAU

4

255

S=262 I=29 E=2.22691e-23

UPF0012 hydrolase in agr operon EC=3.5.-.-

sp_Pdown

sp|P55178|YAG5_STALU

36

255

S=255 I=31 E=1.66873e-22

UPF0012 hydrolase in agr operon

sp_Pdown

sp|P55176|YPQQ_PSEFL

4

251

S=168 I=29 E=5.85871e-12

UPF0012 hydrolase in pqqF 5'region EC=3.5.-.-

Iprscan IPR003010 [G3DSA:3.60.110.10]

4

258

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan IPR003010 [PF00795]

5

153

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan IPR003010 [PS50263]

4

266

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

PDA19380

227

264

S=141 I=76 E=1.47393e-09

PD052217

89

221

S=104 I=30 E=4.44541e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VvVg544j)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

32 hits
swiss-prot

Swiss-Prot ncbi-blastp

17 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQQ_oJ1/XFF4834R_chr23250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.