Xanthomonas fuscans subsp. fuscans

10 hits

  1. XFF4834R_chr04970erpAXFF4834R_chr04970iron-sulfur cluster insertion protein
  2. XFF4834R_chr08560ssuDXFF4834R_chr08560Probable Alkanesulfonate monooxygenase
  3. XFF4834R_chr08570XFF4834R_chr09140807_0994370_r2_XFF4834R-XFF4834R_chr08570XFF4834R_chr08570NADH-dependent FMN reductase
  4. XFF4834R_chr13170cysHXFF4834R_chr13170phosphoadenosine phosphosulfate reductase
  5. XFF4834R_chr13180cysIXFF4834R_chr13180sulfite reductase (NADPH) beta subunit, heme component
  6. XFF4834R_chr13190cysJXFF4834R_chr13190sulfite reductase (NADPH) alpha subunit
  7. XFF4834R_chr13200cysDXFF4834R_chr13200sulfate adenylyltransferase subunit 2
  8. XFF4834R_chr13210cysNXFF4834R_chr13210sulfate adenylyltransferase, subunit 1
  9. XFF4834R_chr16910XFF4834R_chr18100439_1943187_r1_XFF4834R-XFF4834R_chr16910XFF4834R_chr16910putative sulfite reductase
  10. XFF4834R_chr29260sseAXFF4834R_chr29260putative thiosulfate sulfurtransferase

erpA XFF4834R_chr04970
XFF4834R_chr04960
XFF4834R_chr04960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0548
XFF4834R_chr_0548
ID erpA
AC XFF4834R_chr04970
LT XFF4834R_chr04970
OR XFF4834R_chr from 561483 to 561938 on strand +
DE iron-sulfur cluster insertion protein
IP FeS cluster insertion
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: iron-sulfur cluster assembly (GO:0016226)
Molecular Function: structural molecule activity (GO:0005198)
Molecular Function: iron-sulfur cluster binding (GO:0051536)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100702)
MW 15795.4 Da
SQ 151 aa
 
........10........20........30........40........50
| | | | |
MNAAAADAAAWLEVARSGPHAGAMSTLVSLPTAAPAPDYQSIDRPLNFSV
AAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFDENRAEDDLAVA
TDGVTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFS
V
XFF4834R

XFF4834R_chr28880 lcl|sufA-XFF4834R_chr28880

46

151

S=152 I=32 E=2.41181e-12

Fe-S cluster assembly protein

XFF4834R

XFF4834R_chr22160 lcl|nfuA-XFF4834R_chr22160

46

140

S=105 I=32 E=1.19467e-06

predicted gluconate transport associated protein

XFF4834R

NP_640852.1 lcl|XAC0499-XAC0499

24

151

S=670 I=100 E=1.52185e-74

iron-sulfur cluster insertion protein ErpA

XFF4834R

YP_362265.1 lcl|XCV0534

24

151

S=666 I=99 E=4.76875e-74

iron-sulfur cluster insertion protein ErpA

XFF4834R

NP_635880.1 lcl|XCC0488

24

151

S=658 I=98 E=3.73267e-73

iron-sulfur cluster insertion protein ErpA

XFF4834R

lcl|XALc_0301

24

151

S=600 I=89 E=4.53493e-66

hypothetical iron-sulfur cluster assembly accessory protein

XFF4834R

lcl|XALc_1737

40

150

S=176 I=36 E=9.69243e-15

putative iron-sulfur cluster assembly protein (hesb/yadr/yfhf family)

XFF4834R

NP_636933.1 lcl|XCC1562

46

151

S=161 I=32 E=7.00821e-13

hypothetical protein

XFF4834R

NP_641951.1 lcl|XAC1619-XAC1619

46

151

S=158 I=33 E=1.31291e-12

hypothetical protein

XFF4834R

YP_363391.1 lcl|XCV1660

46

151

S=152 I=32 E=8.55724e-12

putative iron-sulfur cluster assembly accessory protein

XFF4834R

lcl|gntY-XALc_1612

46

140

S=106 I=32 E=2.67025e-06

probable protein gnty

XFF4834R

NP_637444.1 lcl|XCC2079

46

140

S=106 I=32 E=3.40859e-06

hypothetical protein

XFF4834R

YP_364160.1 lcl|XCV2429

46

140

S=105 I=32 E=4.27586e-06

thioredoxin-like protein

XFF4834R

NP_642434.1 lcl|XAC2117-XAC2117

46

140

S=105 I=32 E=4.38918e-06

hypothetical protein

pubmed

42

150

S=402 I=65 E=1.37446e-40

Putative uncharacterized protein

Pubmed 16309397

 

prodomImg

pubmed

45

151

S=379 I=64 E=9.58956e-38

Iron-sulfur cluster insertion protein erpA ; Metal-binding

Pubmed 10675023

 

prodomImg

pubmed

45

151

S=373 I=63 E=4.48756e-37

Iron-sulfur cluster insertion protein erpA ; Metal-binding

Pubmed 8202364

 

prodomImg

pubmed

42

151

S=369 I=62 E=1.53429e-36

Iron-sulfur cluster insertion protein erpA ; Metal-binding

Pubmed 9933604

 

prodomImg

pubmed

45

151

S=356 I=63 E=4.72067e-35

Putative uncharacterized protein

Pubmed 16495539

 

prodomImg

sp_Pdown

sp|Q8PQ32|ERPA_XANAC

24

151

S=670 I=100 E=3.67968e-73

Iron-sulfur cluster insertion protein erpA ; Metal-binding

sp_Pdown

sp|Q3BY98|ERPA_XANC5

24

151

S=666 I=99 E=1.15304e-72

Iron-sulfur cluster insertion protein erpA ; Metal-binding

sp_Pdown

sp|Q5H5J1|ERPA_XANOR

24

151

S=661 I=98 E=3.97673e-72

Iron-sulfur cluster insertion protein erpA ; Metal-binding

sp_Pdown

sp|Q2P884|ERPA_XANOM

24

151

S=661 I=98 E=3.97673e-72

Iron-sulfur cluster insertion protein erpA ; Metal-binding

sp_Pdown

sp|Q8PD57|ERPA_XANCP

24

151

S=658 I=98 E=9.02522e-72

Iron-sulfur cluster insertion protein erpA ; Metal-binding

Iprscan IPR000361 [G3DSA:2.60.300.12]

37

137

FeS cluster biogenesis

Iprscan [MF_01380]

30

151

-

Iprscan [PTHR10072:SF26]

40

151

-

Iprscan IPR000361 [PTHR10072]

40

151

FeS cluster biogenesis

Iprscan IPR000361 [PF01521]

47

137

FeS cluster biogenesis

Iprscan IPR016092 [TIGR00049]

46

151

FeS cluster insertion

Iprscan IPR017870 [PS01152]

132

149

FeS cluster insertion, C-terminal, conserved site

Iprscan [seg]

3

10

-

PD873447

93

151

S=137 I=44 E=4.09233e-09

PD002183

71

136

S=129 I=53 E=3.20321e-08

PD365844

24

48

S=129 I=100 E=3.49503e-08

PD983131

70

149

S=122 I=26 E=2.93331e-07

PD286222

52

138

S=107 I=30 E=1.87725e-05

PD869390

102

150

S=101 I=41 E=8.2647e-05

Iprscan IPR000361 [SSF89360]

44

141

FeS cluster biogenesis

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hrfN85jv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

47 hits
swiss-prot

Swiss-Prot ncbi-blastp

363 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr04970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr04970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr04970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr04970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ssuD XFF4834R_chr08560
XFF4834R_chr08550
XFF4834R_chr08550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08570
XFF4834R_chr08570
ID ssuD
AC XFF4834R_chr08560
LT XFF4834R_chr08560
OR XFF4834R_chr from 992434 to 993597 on strand -
DE Probable Alkanesulfonate monooxygenase
IP Luciferase-like; Alkanesulphonate monooxygenase, FMN-dependent
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro


Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100817)
MW 42097.2 Da
SQ 387 aa
 
........10........20........30........40........50
| | | | |
MDMFWFIPTHGDSRYLGTSDGARQVSAEYVTQVAVAADTLGYEGVLIPTG
RSCEDPWVIASSLINATRRLKFLVALRPGLMAPALAARTAASFDRLSGGR
LLVNLVTGGDRGELEGDGVFLDHAERYEASAEFIRIWREIIAHSHSGESY
DFDGKHLQVKAAKLLYPTVQRPYPPVWFGGSSDAAHDLAAEQVDTYLTWG
EPPDAVAEKIASVRSKAAALGRTLTFGIRLHVIVRETEAEAWAAAESLIS
HLDDETVERAQSAFARMDSVGQRRMAALHSRGQRRTRADLEVSPNLWAGV
GLVRGGAGTALVGDPQTVAKRIEEYAALGIDTFIFSGYPHLEEAYRFAEL
VFPLLPRTLKQKLPGQALSGPFGEVIANTIVPRASAR
XFF4834R

NP_641202.1 lcl|ssuD-XAC0850

1

387

S=1888 I=94 E=0

alkanesulfonate monooxygenase

pubmed

1

387

S=1261 I=63 E=5.64019e-144

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

Pubmed 10781557,12835925

 

prodomImg

pubmed

1

386

S=1243 I=64 E=8.7075e-142

Methanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

Pubmed 10049377

 

prodomImg

pubmed

1

387

S=1236 I=62 E=6.52494e-141

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

Pubmed 10506196

 

prodomImg

pubmed

1

385

S=1217 I=62 E=9.98596e-139

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

Pubmed 17965706

 

prodomImg

pubmed

1

387

S=1193 I=63 E=8.51421e-136

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

Pubmed 9611812

 

prodomImg

sp_Pdown

sp|Q8PP38|SSUD_XANAC

1

387

S=1888 I=94 E=0

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

sp_Pdown

sp|A1VPZ7|SSUD_POLNA

1

385

S=1547 I=76 E=7.27225e-179

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

sp_Pdown

sp|B2UAU3|SSUD_RALPJ

1

386

S=1511 I=73 E=1.74846e-174

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

sp_Pdown

sp|Q1LNM2|SSUD_RALME

1

385

S=1491 I=73 E=5.37513e-172

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

sp_Pdown

sp|C5CNW9|SSUD_VARPS

1

382

S=1491 I=74 E=5.61463e-172

Alkanesulfonate monooxygenase EC=1.14.14.5 ; FMN Oxidoreductase

Iprscan IPR011251 [G3DSA:3.20.20.30]

1

368

Luciferase-like

Iprscan [MF_01229]

1

387

-

Iprscan IPR016048 [PF00296]

1

331

Luciferase-like, subgroup

Iprscan IPR019911 [TIGR03565]

2

355

Alkanesulphonate monooxygenase, FMN-dependent

Iprscan [seg]

82

91

-

Iprscan [seg]

236

246

-

PD415239

2

357

S=535 I=40 E=3.08149e-57

PD724997

347

386

S=173 I=85 E=2.09577e-13

PD744790

30

191

S=151 I=27 E=8.66599e-11

PD098425

92

206

S=144 I=43 E=7.33689e-10

PDA4Y4Q2

292

355

S=125 I=41 E=1.40856e-07

PDA005Q5

1

30

S=108 I=57 E=1.5613e-05

PDA1D3X1

92

226

S=105 I=29 E=3.1914e-05

Iprscan IPR011251 [SSF51679]

1

357

Luciferase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4yIHTuJP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

78 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr09140807_0994370_r2_XFF4834R-XFF4834R_chr08570 XFF4834R_chr08570
XFF4834R_chr08560
XFF4834R_chr08560
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08580
XFF4834R_chr08580
ID XFF4834R_chr09140807_0994370_r2_XFF4834R-XFF4834R_chr08570
AC XFF4834R_chr08570
LT XFF4834R_chr08570
OR XFF4834R_chr from 993807 to 994370 on strand -
DE NADH-dependent FMN reductase
IP NADPH-dependent FMN reductase; FMN reductase, MsuE-like
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro


Curated
PM
AN classification is made according to functional studies in Pseudomonas aeruginosa and to E. coli annotation for the same enzyme
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120329)
MW 20177 Da
SQ 187 aa
 
........10........20........30........40........50
| | | | |
MRSPLNVVAVSGSTSRPSRSLALAEATLAELGQRVAIRPSIIQLGDIARP
LGAALWRSELGEAAEQALRQIESADLLLVVAPVYRGSYPGLLKHLFDLID
INALIDTPILLAATGGSERHALVIDHQLRPLFSFFQAVTLPIGIYATETD
FHEYRVVNPAVRQRIELAAERAAGVLGARTDALLRIA
XFF4834R

XFF4834R_chr03080 lcl|XFF4834R_chr03270323_0360865_f2_XFF4834R-XFF4834R_chr03080

15

172

S=444 I=54 E=1.30152e-47

XFF4834R

XFF4834R_chr03080 lcl|XFF4834R_chr03270323_0360865_f2_XFF4834R-XFF4834R_chr03080

15

172

S=444 I=54 E=1.30152e-47

XFF4834R

NP_641203.1 lcl|slfA-XAC0851

1

187

S=870 I=93 E=1.01965e-98

NADH-dependent FMN reductase

XFF4834R

YP_362074.1 lcl|XCV0343

1

172

S=493 I=55 E=5.10247e-53

NADH-dependent FMN reductase

XFF4834R

NP_640690.1 lcl|sflA-XAC0334

1

172

S=484 I=54 E=7.10076e-52

NADH-dependent FMN reductase

XFF4834R

NP_635711.1 lcl|sflA-XCC0316

1

172

S=483 I=55 E=9.38584e-52

NADH-dependent FMN reductase

pubmed

1

187

S=594 I=63 E=9.81473e-64

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

Pubmed 10049377

 

prodomImg

pubmed

1

179

S=545 I=61 E=9.02867e-58

NADH-dependent FMN reductase

Pubmed 12835925,12686641

 

prodomImg

pubmed

3

166

S=362 I=47 E=1.3354e-35

NADH-dependent FMN reductase

Pubmed 15661012,12835925

 

prodomImg

pubmed

69

170

S=159 I=35 E=5.86389e-11

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

Pubmed 10506196

 

prodomImg

pubmed

6

132

S=143 I=35 E=5.27257e-09

NADH-dependent FMN reductase

Pubmed 11157233,11157232

 

prodomImg

pubmed

71

149

S=140 I=41 E=9.79183e-09

NADPH-dependent FMN reductase

Pubmed 12835925

 

prodomImg

pubmed

71

160

S=139 I=38 E=1.51422e-08

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

Pubmed 10781557

 

prodomImg

sp_Pdown

sp|O31038|MSUE_PSEAE

1

187

S=594 I=63 E=6.81061e-64

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

sp_Pdown

sp|Q88J85|MSUE_PSEPK

5

166

S=350 I=47 E=2.5456e-34

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

sp_Pdown

sp|P80644|SSUE_ECOLI

69

170

S=159 I=35 E=4.06905e-11

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

sp_Pdown

sp|Q88R97|SSUE_PSEPK

71

171

S=140 I=37 E=7.67684e-09

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

sp_Pdown

sp|O85762|SSUE_PSEPU

71

160

S=139 I=38 E=1.05074e-08

FMN reductase EC=1.5.1.29 ; NAD Oxidoreductase

PD235510

95

176

S=186 I=44 E=4.94423e-15

PD799934

94

117

S=110 I=83 E=6.54319e-06

PD543739

40

93

S=102 I=44 E=6.20451e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one byyB3AAo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08570.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08570.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr08570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cysH XFF4834R_chr13170
XFF4834R_chr_4645
XFF4834R_chr_4645
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13180
XFF4834R_chr13180
ID cysH
AC XFF4834R_chr13170
LT XFF4834R_chr13170
OR XFF4834R_chr from 1501115 to 1501840 on strand -
DE phosphoadenosine phosphosulfate reductase
IP Phosphoadenosine phosphosulphate reductase CysH-type; Phosphoadenosine phosphosulphate reductase thioredoxin; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: cysteine biosynthetic process (GO:0019344)
Molecular Function: phosphoadenylyl-sulfate reductase (thioredoxin) activity (GO:0004604)
Molecular Function: transferase activity (GO:0016740)
phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin) (GO:0019379)

Curated
PM
AN
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by koebnik (20101112)
MW 27679 Da
SQ 241 aa
 
........10........20........30........40........50
| | | | |
MTALPAASITSSAFDDLDALNAQLEGLRADQRVAWALQHGPQNAALSSSF
GAQSAVTLHLLSQQRPDIPVILIDTGYLFPETYRFADALTERLKLNLKVY
RPLVSRAWMEARHGRLWEQGMVGIDQYNNLRKVEPMRRALDELDVGTWFT
GLRRSQSGGRAQTPIVQKRGERYKISPIADWTDRDVWQYLQAHDLPYHPL
WEQGYVSIGDFHTTRRWEPGMREEDTRFFGLKRECGIHEDI
pubmed

1

241

S=1246 I=96 E=1.56535e-142

PAPS reductase ; Oxidoreductase

Pubmed 11967067

 

prodomImg

pubmed

21

239

S=809 I=67 E=1.43369e-89

PAPS reductase ; Oxidoreductase

Pubmed 16885444

 

prodomImg

pubmed

17

239

S=800 I=65 E=1.60442e-88

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 2670946

 

prodomImg

pubmed

21

239

S=798 I=65 E=3.39592e-88

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 2005873,2670946

 

prodomImg

pubmed

21

238

S=702 I=62 E=1.22284e-76

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 8695637

 

prodomImg

pubmed

17

238

S=603 I=55 E=1.18972e-64

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 1463852

 

prodomImg

pubmed

17

238

S=305 I=36 E=1.63625e-28

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Amino-acid biosynthesis Cysteine Methionine NADP Oxidoreductase

Pubmed 7770049

 

prodomImg

pubmed

17

238

S=304 I=37 E=2.20085e-28

3'-phosphoadenosine-5'-phosphosulfate reductase

Pubmed 11010912

 

prodomImg

pubmed

1

238

S=303 I=32 E=2.8094e-28

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Oxidoreductase

Pubmed 18043661

 

prodomImg

pubmed

15

239

S=298 I=35 E=1.30328e-27

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Amino-acid biosynthesis Cysteine Methionine NADP Oxidoreductase

Pubmed 2203779

 

prodomImg

sp_Pdown

sp|Q3BPY3|CYSH_XANC5

1

241

S=1273 I=99 E=6.25365e-146

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

sp_Pdown

sp|Q8PHC7|CYSH_XANAC

1

241

S=1272 I=99 E=8.41153e-146

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

sp_Pdown

sp|B2SI06|CYSH_XANOP

1

241

S=1259 I=98 E=2.94964e-144

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

sp_Pdown

sp|Q2P0H1|CYSH_XANOM

1

241

S=1259 I=98 E=2.94964e-144

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

sp_Pdown

sp|Q8P607|CYSH_XANCP

1

241

S=1208 I=93 E=4.1235e-138

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Iprscan IPR014729 [G3DSA:3.40.50.620]

16

212

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [PTHR23293]

175

216

-

Iprscan IPR002500 [PF01507]

44

215

Phosphoadenosine phosphosulphate reductase

Iprscan IPR011800 [TIGR02057]

17

238

Phosphoadenosine phosphosulphate reductase thioredoxin

Iprscan IPR004511 [TIGR00434]

29

239

Phosphoadenosine phosphosulphate reductase CysH-type

PDA1F7G5

125

193

S=198 I=55 E=1.66e-16

PD858201

1

37

S=170 I=95 E=3.95977e-13

PD002993

10

97

S=159 I=41 E=8.97922e-12

PDA1G2R1

96

128

S=107 I=65 E=2.01005e-05

Iprscan [SSF52402]

16

212

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0QoOzOMh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

38 hits
swiss-prot

Swiss-Prot ncbi-blastp

154 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cysI XFF4834R_chr13180
XFF4834R_chr13170
XFF4834R_chr13170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13190
XFF4834R_chr13190
ID cysI
AC XFF4834R_chr13180
LT XFF4834R_chr13180
OR XFF4834R_chr from 1501837 to 1503543 on strand -
DE sulfite reductase (NADPH) beta subunit, heme component
IP Sulphite reductase (NADPH) hemoprotein, beta subunit
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
4 sulfur cluster binding (GO:0051539)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: sulfite reductase complex (NADPH) (GO:0009337)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: NADP or NADPH binding (GO:0050661)
Molecular Function: heme binding (GO:0020037)
Molecular Function: sulfite reductase (NADPH) activity (GO:0004783)
Molecular Function: iron-sulfur cluster binding (GO:0051536)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100709)
MW 62489.9 Da
SQ 568 aa
 
........10........20........30........40........50
| | | | |
MSHSVEDIKSESRRLRGSLEQSLADAVTGALREDDQTLIKYHGSYQQDDR
DIRDERRRQKLEPAYQFMIRTRTPGGVITPTQWLALDGIATRYANHSLRI
TTRQAFQFHGVIKRELKATMQAINATLIDTLAACGDVNRNVQVAANPLLS
QAHATLYADAARVSEHLLPNTRAYYEIWLDEERVSGSGSEDEPIYGERYL
PRKFKIGFAAPPLNDVDVFANDLGFIAILRDGQLLGYNVSIGGGMGASHG
DAETWPRVANVIGFVTRDQLLDIATAVVTTQRDFGNRAVRKRARFKYTID
DHGLDTIVAEIARRAGFALQPAQPFAFDHNGDRYGWVEGEDGLWHLTLSL
PAGRIADTDTAAHLSGLRAIAQLNVGEFRMTPNQNLVIADVLASQRARVD
ALVAHYGLDAGNQSATALARGAMACVALPTCGLAMAEAERYLPDFSAALQ
PLLQQHGLAETPIVLRLSGCPNGCSRPYLAEIALVGKAPGRYNLMLGGDR
RGQRLNTLYRENITEPEILAALEPLLARYAAERDHANDEGFGDFLHRAGV
IALPPYPTHRRLDLELLA
XFF4834R

NP_643638.1 lcl|cysI-XAC3331

1

568

S=2816 I=95 E=0

sulfite reductase subunit beta

XFF4834R

YP_365179.1 lcl|cysI-XCV3448

1

568

S=2762 I=92 E=0

sulfite reductase subunit beta

XFF4834R

NP_638520.1 lcl|cysI-XCC3174

1

568

S=2635 I=88 E=0

sulfite reductase subunit beta

pubmed

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding

Pubmed 11967067

 

prodomImg

pubmed

5

551

S=1591 I=52 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding

Pubmed 11445163

 

prodomImg

pubmed

5

551

S=1568 I=51 E=0

YvgQ ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding NADP Oxidoreductase

Pubmed 10972189

 

prodomImg

pubmed

6

552

S=1473 I=54 E=1.54829e-169

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

Pubmed 19440302

 

prodomImg

pubmed

3

551

S=1392 I=52 E=1.14152e-159

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidoredu

Pubmed 8695637

 

prodomImg

sp_Pdown

sp|Q8PHC8|CYSI_XANAC

1

568

S=2816 I=95 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

sp_Pdown

sp|Q3BPY4|CYSI_XANC5

1

568

S=2763 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

sp_Pdown

sp|Q8KQT8|CYSI_XANOR

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding

sp_Pdown

sp|B2SI05|CYSI_XANOP

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

sp_Pdown

sp|Q2P0H2|CYSI_XANOM

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidoreductase

Iprscan IPR006066 [PR00397]

420

438

Nitrite/sulphite reductase iron-sulphur/siroheam-binding site

Iprscan IPR006066 [PR00397]

468

486

Nitrite/sulphite reductase iron-sulphur/siroheam-binding site

Iprscan [G3DSA:3.30.413.10]

135

328

-

Iprscan [G3DSA:3.30.413.10]

416

563

-

Iprscan IPR006067 [PF01077]

161

316

Nitrite/sulphite reductase 4Fe-4S domain

Iprscan IPR005117 [PF03460]

63

125

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Iprscan IPR005117 [PF03460]

340

404

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Iprscan IPR011786 [TIGR02041]

6

551

Sulphite reductase (NADPH) hemoprotein, beta subunit

Iprscan IPR006066 [PS00365]

468

484

Nitrite/sulphite reductase iron-sulphur/siroheam-binding site

Iprscan [seg]

46

59

-

Iprscan [seg]

515

527

-

PD392958

135

220

S=247 I=52 E=2.40981e-22

PD000955

423

482

S=167 I=54 E=1.13895e-12

PD386778

344

410

S=163 I=46 E=3.44659e-12

PD581155

335

423

S=145 I=36 E=5.70535e-10

PD013199

5

65

S=136 I=48 E=6.84598e-09

PD126478

67

135

S=129 I=44 E=4.5803e-08

PDA1I399

313

339

S=126 I=78 E=1.0395e-07

Iprscan [SSF56014]

135

333

-

Iprscan [SSF56014]

417

563

-

Iprscan IPR005117 [SSF55124]

334

413

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Iprscan IPR005117 [SSF55124]

68

131

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one u436dtrM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

80 hits
swiss-prot

Swiss-Prot ncbi-blastp

192 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cysJ XFF4834R_chr13190
XFF4834R_chr13180
XFF4834R_chr13180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13200
XFF4834R_chr13200
ID cysJ
AC XFF4834R_chr13190
LT XFF4834R_chr13190
OR XFF4834R_chr from 1503667 to 1505514 on strand -
DE sulfite reductase (NADPH) alpha subunit
IP Flavodoxin/nitric oxide synthase; Sulphite reductase [NADPH] flavoprotein, alpha chain; Ferredoxin--NADP reductase; Riboflavin synthase-like beta-barrel
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: cysteine biosynthetic process (GO:0019344)
Biological Process: sulfate assimilation (GO:0000103)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: sulfite reductase (NADPH) activity (GO:0004783)
Molecular Function: FMN binding (GO:0010181)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100709)
MW 66452.2 Da
SQ 615 aa
 
........10........20........30........40........50
| | | | |
MTAASSTLAPSPLPDERKVLLDRLVDGLDTASLWWLSGYAAGLAQGHPPR
SLAVLPGGQAHALAQEGQRLTVVYGSQTGNARREAEHLAAEAEAAGLSVR
LVRADAYPTRELASERLLYVVISTQGEGDPPDDAIGLVEFLTSRRAPKVP
ELKYAVLGLGDSSYADFCGIARRIDERLAELGGSRVQPRGEADLDIDSVA
VPWRAQALTRARAQLKGGLHSATVTPLRSSPATPVWSHQQPFAAELLSNQ
IISGRDFKGPGFRVYAAPGKRVRHLEFSLQGSGLSYEPGDALGIRHRNPP
ALVDAVLQTLRLDGDAAVTVGEQTLALHAWLATQRELTKLSRPFLTAHAE
RAGAQELQALLDPTQTAGLASLLADHQVIDVLRRWPADWDHAGLLAALRP
LTPRLYSIASSRKRVGDEVHLAVDEVTYQAHGHAHLGAASGFLAALGEGD
TAPVYIEPNERFRVPADADRDILMIGPGTGVAPFRGFVQERAETGAKGRN
WLFFGAQHFNTDFLYQAEWQQALQRGELHALDLAFSRDQAEKLYVQHRLR
ARGAEVYAWLQGGAHVYVCGAISMGKDVHAALLEIVASHGALDAEAASAY
LTQLQVEGRYARDVY
XFF4834R

XFF4834R_chr39020 lcl|XFF4834R_chr42170865_4495465_r3_XFF4834R-XFF4834R_chr39020

472

615

S=237 I=40 E=6.39251e-22

XFF4834R

XFF4834R_chr39020 lcl|XFF4834R_chr42170865_4495465_r3_XFF4834R-XFF4834R_chr39020

72

178

S=150 I=35 E=2.47024e-11

XFF4834R

XFF4834R_chr16910 lcl|XFF4834R_chr18100439_1943187_r1_XFF4834R-XFF4834R_chr16910

456

615

S=214 I=41 E=3.61793e-19

XFF4834R

XFF4834R_chr16910 lcl|XFF4834R_chr18100439_1943187_r1_XFF4834R-XFF4834R_chr16910

66

193

S=169 I=32 E=1.06212e-13

XFF4834R

NP_643637.1 lcl|cysJ-XAC3330

1

615

S=2714 I=88 E=0

NADPH-sulfite reductase flavoprotein subunit

XFF4834R

YP_365178.1 lcl|cysJ-XCV3447

1

615

S=2651 I=86 E=0

NADPH-sulfite reductase flavoprotein subunit

XFF4834R

NP_638519.1 lcl|cysJ-XCC3173

1

615

S=2464 I=80 E=0

NADPH-sulfite reductase flavoprotein subunit

XFF4834R

NP_639294.1 lcl|piuB-XCC3955

472

615

S=250 I=43 E=6.06201e-23

iron-uptake factor

XFF4834R

NP_639294.1 lcl|piuB-XCC3955

74

193

S=157 I=35 E=1.31648e-11

iron-uptake factor

XFF4834R

NP_644335.2 lcl|piuB-XAC4036

472

615

S=232 I=40 E=1.01227e-20

iron-uptake factor

XFF4834R

NP_644335.2 lcl|piuB-XAC4036

59

201

S=157 I=32 E=1.38718e-11

iron-uptake factor

XFF4834R

YP_365859.1 lcl|XCV4128

472

615

S=230 I=39 E=2.01572e-20

Iron uptake factor (C-terminal fragment)

XFF4834R

YP_365859.1 lcl|XCV4128

72

201

S=159 I=33 E=6.66907e-12

Iron uptake factor (C-terminal fragment)

XFF4834R

lcl|XALc_2995

472

615

S=226 I=43 E=5.07924e-20

hypothetical iron-uptake factor protein

XFF4834R

lcl|XALc_2995

96

193

S=144 I=41 E=4.38115e-10

hypothetical iron-uptake factor protein

XFF4834R

NP_643257.2 lcl|XAC2948-XAC2948

456

615

S=177 I=38 E=4.5123e-14

sulfite reductase

XFF4834R

NP_643257.2 lcl|XAC2948-XAC2948

70

193

S=164 I=31 E=1.93367e-12

sulfite reductase

XFF4834R

YP_364823.1 lcl|XCV3092

456

615

S=172 I=38 E=1.8049e-13

sulfite reductase (NADPH)

XFF4834R

YP_364823.1 lcl|XCV3092

70

193

S=166 I=32 E=1.09713e-12

sulfite reductase (NADPH)

XFF4834R

NP_638127.1 lcl|XCC2779

456

615

S=156 I=40 E=1.6952e-11

sulfite reductase

XFF4834R

NP_638127.1 lcl|XCC2779

70

193

S=152 I=31 E=5.22012e-11

sulfite reductase

pubmed

1

615

S=2643 I=84 E=0

Sulfite reductase flavoprotein ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN NADP Oxidoreductase

Pubmed 11967067

 

prodomImg

pubmed

11

615

S=1041 I=38 E=4.1839e-117

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

Pubmed 11445163

 

prodomImg

pubmed

1

615

S=981 I=38 E=7.86064e-110

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

Pubmed 2550423

 

prodomImg

pubmed

1

615

S=981 I=39 E=8.42849e-110

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

Pubmed 2550423

 

prodomImg

pubmed

70

615

S=972 I=40 E=9.18866e-109

Sulfite reductase subunit II ; Amino-acid biosynthesis Cysteine Electron transport FAD Flavoprotein FMN NADP Oxidoreductase

Pubmed 16885444

 

prodomImg

sp_Pdown

sp|Q9KUX4|CYSJ_VIBCH

11

615

S=1046 I=40 E=6.29801e-118

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

sp_Pdown

sp|A5F3I4|CYSJ_VIBC3

11

615

S=1045 I=40 E=8.62021e-118

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

sp_Pdown

sp|O32214|CYSJ_BACSU

11

615

S=1041 I=38 E=2.84622e-117

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

sp_Pdown

sp|Q8EAZ9|CYSJ_SHEON

6

615

S=1035 I=39 E=1.67082e-116

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

sp_Pdown

sp|Q6LM58|CYSJ_PHOPR

11

615

S=1030 I=38 E=5.51672e-116

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

Iprscan IPR001709 [PR00371]

286

296

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

404

411

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

473

492

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

498

507

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

511

522

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

542

558

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

565

573

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001094 [PR00369]

71

84

Flavodoxin-like

Iprscan IPR001094 [PR00369]

119

130

Flavodoxin-like

Iprscan IPR001094 [PR00369]

151

161

Flavodoxin-like

Iprscan IPR001094 [PR00369]

175

194

Flavodoxin-like

Iprscan [G3DSA:3.40.50.360]

67

217

-

Iprscan [G3DSA:1.20.990.10]

296

402

-

Iprscan [G3DSA:3.40.50.80]

463

615

-

Iprscan [PTHR19384:SF18]

107

615

-

Iprscan [PTHR19384]

107

615

-

Iprscan IPR008254 [PF00258]

72

195

Flavodoxin/nitric oxide synthase

Iprscan IPR003097 [PF00667]

269

442

FAD-binding, type 1

Iprscan IPR001433 [PF00175]

474

579

Oxidoreductase FAD/NAD(P)-binding

Iprscan IPR010199 [TIGR01931]

8

615

Sulphite reductase [NADPH] flavoprotein, alpha chain

Iprscan IPR008254 [PS50902]

70

208

Flavodoxin/nitric oxide synthase

Iprscan IPR017927 [PS51384]

239

465

Ferredoxin reductase-type FAD-binding domain

Iprscan [seg]

81

95

-

Iprscan [seg]

204

215

-

Iprscan [seg]

394

405

-

Iprscan [seg]

430

449

-

PD000183

472

615

S=338 I=52 E=2.62162e-33

PD266648

1

71

S=292 I=80 E=9.82438e-28

PDA1K3Y4

187

257

S=260 I=72 E=5.85397e-24

PD819349

121

188

S=192 I=51 E=1.2308e-15

PD610387

132

191

S=142 I=51 E=1.33622e-09

PDA2V9T2

450

473

S=126 I=100 E=1.15022e-07

PD037069

236

300

S=118 I=44 E=1.06253e-06

PDA621R0

451

473

S=114 I=91 E=3.44762e-06

PDA658K4

450

472

S=104 I=83 E=4.92496e-05

Iprscan IPR017938 [SSF63380]

231

463

Riboflavin synthase-like beta-barrel

Iprscan [SSF52343]

461

615

-

Iprscan [SSF52218]

53

223

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ass9XO6v)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

327 hits
swiss-prot

Swiss-Prot ncbi-blastp

210 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

29 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0_iIj5/XFF4834R_chr13190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cysD XFF4834R_chr13200
XFF4834R_chr13190
XFF4834R_chr13190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13210
XFF4834R_chr13210
ID cysD
AC XFF4834R_chr13200
LT XFF4834R_chr13200
OR XFF4834R_chr from 1505694 to 1506602 on strand +
DE sulfate adenylyltransferase subunit 2
IP Sulphate adenylyltransferase, small subunit
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: sulfate reduction (GO:0019419)
Biological Process: metabolic process (GO:0008152)
Molecular Function: transferase activity (GO:0016740)
Molecular Function: sulfate adenylyltransferase (ATP) activity (GO:0004781)

Curated
PM
AN highly similar to raxP from X. oryzae pv. oryzae
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20101112)
MW 34175.9 Da
SQ 302 aa
 
........10........20........30........40........50
| | | | |
MTLPPLSHLDRLEAESIHILREVAAEFRVPVMLYSVGKDSSVLLHLLLKA
FAPSRPPIPLLHIDTRWKFREMIAFRDRRAAETGVDLRVHINPDGVVQDV
GPISHGAAVHTDIMKTQGLKQALEHGGFDAAIGGARRDEEKSRAKERVFS
FRTARHRWDPKNQRPELWNLYNARTGPGESVRVFPLSNWTELDIWLYIYR
ERIPVVPLYLAAPRPVVERDGAWIMVDDARLPLHPGETPQLRSVRFRTLG
CYPLTGAIDSNADTLEAVIAEMLVSTSSERQGRMIDHAPGASMEQKKLEG
YF
XFF4834R

NP_643636.1 lcl|cysD-XAC3329

1

302

S=1578 I=99 E=0

sulfate adenylyltransferase subunit 2

XFF4834R

YP_365177.1 lcl|cysD-XCV3446

1

302

S=1563 I=98 E=0

sulfate adenylyltransferase subunit 2

XFF4834R

NP_638518.1 lcl|cysD-XCC3172

1

302

S=1521 I=95 E=2.84835e-177

sulfate adenylyltransferase subunit 2

XFF4834R

lcl|XALc_2297

1

302

S=1254 I=81 E=5.81889e-145

putative sulfate adenylyltransferase protein

pubmed

1

302

S=1536 I=96 E=1.74338e-177

ATP sulfurylase small subunit RaxP ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 11967067

 

prodomImg

pubmed

6

302

S=1166 I=70 E=1.33852e-132

Putative small subunit ATP sulfurylase ; ATP-binding Nucleotide-binding Nucleotidyltransferase Plasmid

Pubmed 12673061

 

prodomImg

pubmed

6

302

S=1093 I=65 E=8.22435e-124

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 9611812

 

prodomImg

pubmed

6

302

S=1084 I=68 E=1.05815e-122

ATP sulfurylase D subunit ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 11114933

 

prodomImg

pubmed

6

302

S=1080 I=68 E=3.01251e-122

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 1316900

 

prodomImg

sp_Pdown

sp|Q8PHD0|CYSD_XANAC

1

302

S=1578 I=99 E=0

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|Q3BPY6|CYSD_XANC5

1

302

S=1563 I=98 E=0

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|B2SI03|CYSD_XANOP

1

302

S=1536 I=96 E=1.19831e-177

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|Q2P0H4|CYSD_XANOM

1

302

S=1536 I=96 E=1.19831e-177

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|Q8P610|CYSD_XANCP

1

302

S=1521 I=95 E=8.08072e-176

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Iprscan IPR014729 [G3DSA:3.40.50.620]

13

209

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [MF_00064]

4

302

-

Iprscan IPR011784 [PIRSF002936]

6

302

Sulphate adenylyltransferase, small subunit

Iprscan IPR002500 [PF01507]

30

257

Phosphoadenosine phosphosulphate reductase

Iprscan IPR011784 [TIGR02039]

9

302

Sulphate adenylyltransferase, small subunit

PD867396

86

179

S=370 I=73 E=2.27682e-37

PD002993

7

87

S=223 I=56 E=1.2837e-19

PD006993

251

301

S=174 I=67 E=1.1207e-13

PD002340

181

211

S=149 I=81 E=1.28525e-10

PDA1S917

79

107

S=144 I=97 E=5.14093e-10

PDA1F945

215

250

S=132 I=72 E=1.63789e-08

PDA1H947

86

114

S=103 I=59 E=5.20956e-05

Iprscan [SSF52402]

8

253

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL