Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr10430ppxXFF4834R_chr10430probable exopolyphosphatase
  2. XFF4834R_chr10440ppkXFF4834R_chr10440probable polyphosphate kinase
  3. XFF4834R_chr25300XFF4834R_chr_2918695_2919816_r1_XFF4834R-XFF4834R_chr25300XFF4834R_chr25300Putative phytase protein
  4. XFF4834R_chr40020XFF4834R_chr_4621933_4623327_f1_XFF4834R-XFF4834R_chr40020XFF4834R_chr40020putative acid phosphatase protein

ppx XFF4834R_chr10430
XFF4834R_chr10420
XFF4834R_chr10420
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10440
XFF4834R_chr10440
ID ppx
AC XFF4834R_chr10430
LT XFF4834R_chr10430
OR XFF4834R_chr from 1184052 to 1185578 on strand -
DE probable exopolyphosphatase
IP Ppx/GppA phosphatase
CL 1.8.1 Phosphorous metabolism GO:0006793
EC
GO InterPro


Curated
PM
AN
CC COG: [FP] Nucleotide transport and metabolism;Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 55932.9 Da
SQ 508 aa
 
........10........20........30........40........50
| | | | |
MPLPSPTIPPLRDGDFLAAIDLGSNSFHMVIARYLMGQLRVVDRLRETVR
MADGLDGKGGLSNEARQRALECLARFGQRIRDVPSLRVRALATNTVRQLR
SPQAFLMPAETALGHAIEVVSGREEARLIYLGVAHAQPPKPDQRRLVIDI
GGGSTEFIIGRGFQTLERESLQAGCIASTRRFFPGGKLSKKKWKDALTEI
GAEFQQFAGQYKALGWHEAIGSSGTHKAIGEMCAAMKLTKGAITAQALPA
LREELLKAKRIEDIQLPGLAAERRPIIAGGILVLEAAFQALGLEKLMVSK
AAMREGILYDMLGRGGENDPRDSSVTSLMQRYGIDEIQAQRVEATACRLF
DQVCESWQLDGDDAQVLRRAARLHELGLIIAHSQYHVHGSYILEHSDIAG
FSRQEQQVLASLVRTHRRNVPKTAFDALPDRLLLPTRRKAALLRLAVLLH
RAHESDPIPTLELTADDTRLSLILSQSWIDSRPLLRADLIGEVDSMAGLG
IAFKPFVT
Show or not Domain decomposition
 
XFF4834R

NP_641386.1 lcl|ppx-XAC1039

1

508

S=2518 I=95 E=0

exopolyphosphatase

XFF4834R

YP_362800.1 lcl|ppx-XCV1069

1

508

S=2512 I=95 E=0

exopolyphosphatase

XFF4834R

NP_636346.1 lcl|ppx-XCC0960

1

508

S=2453 I=92 E=0

exopolyphosphatase

XFF4834R

lcl|ppx-XALc_0572

1

507

S=2110 I=79 E=0

probable exopolyphosphatase protein

Iprscan [G3DSA:3.30.420.40]

4

137

-

Iprscan [G3DSA:3.30.420.150]

140

318

-

Iprscan IPR003695 [PF02541]

30

313

Ppx/GppA phosphatase

Iprscan [TIGR03706]

16

313

-

Iprscan [seg]

431

452

-

Iprscan [SSF53067]

141

314

-

Iprscan [SSF53067]

13

138

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FMsHNroI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

83 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10430.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10430.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ppk XFF4834R_chr10440
XFF4834R_chr10430
XFF4834R_chr10430
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10450
XFF4834R_chr10450
ID ppk
AC XFF4834R_chr10440
LT XFF4834R_chr10440
OR XFF4834R_chr from 1185749 to 1187851 on strand -
DE probable polyphosphate kinase
IP Polyphosphate kinase
CL 1.8.1 Phosphorous metabolism GO:0006793
EC
GO InterPro
Biological Process: polyphosphate biosynthetic process (GO:0006799)
Cellular Component: polyphosphate kinase complex (GO:0009358)
Molecular Function: polyphosphate kinase activity (GO:0008976)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100630)
MW 78461.4 Da
SQ 700 aa
 
........10........20........30........40........50
| | | | |
MGHAKELHDITPGDDVATDPLRDPALYINRELSQLDFNFRVLAQALDEQV
PLLERLRFLCISCTNLDEFFEIRAATVRHAQEFGLPPAPDGLSPTAILNA
VHDRAAKLVEQQYHAWNEVLRPAMEDAGVAVLSRSAWTARQKRWLRAYFR
NEIMPVLSPLGLDPAHPFPKILNKTLNIVVVLEGQDAFGRAGHLAIVRAP
RSLPRIIQLPASLSPEGTQSFVFLSSVLSEFVDELFPGMQVMGSYQFRVT
RNSELVVDEEEVENLALALRDELVTRGYRPAVRLEIAHDCPAPILRTLLQ
NFGLNENAVYRITGPVNLSRVTQVYDLVQRPELKYPSFNPRTLRDSEGIF
EIVKKGDVLLHHPFDAFTAVLDVIRQAAVDPNVLAIKQTLYRTGKDSLIV
DALILAARNGKDVTVVVELRARFDEEANLGLADKLQEAGVQVVYGVVGFK
THAKMLLIVRREGRKLKRYVHLGTGNYHSGTARLYTDLSLITADAEIGND
VHMLFQQLSGLAPRMKLDQLLQSPFTLHAGVLKRIDRETRLARKGRPGRI
IAKMNALNEPQVVRALYTASQAGVQIDLIVRGACTLRPGVPGVSDNIRVR
SIVGRFLEHSRVYWFGNDGAAELYCASADWLERNLLRRVETCFPILEPDL
AKRVYREVLQNYLDDNVSAWELDAEGVYHKRTPAPGEPAHSAQMTLLERI
XFF4834R

NP_641387.1 lcl|ppk-XAC1040

1

700

S=3476 I=96 E=0

polyphosphate kinase

XFF4834R

YP_362801.1 lcl|ppk-XCV1070

1

700

S=3463 I=96 E=0

polyphosphate kinase

XFF4834R

NP_636347.1 lcl|ppk-XCC0961

1

700

S=3283 I=90 E=0

polyphosphate kinase

XFF4834R

lcl|ppk-XALc_0573

21

698

S=2863 I=81 E=0

probable polyphosphate kinase; protein

pubmed

23

700

S=1888 I=54 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

Pubmed 9734809,10224002

 

prodomImg

pubmed

27

697

S=1841 I=52 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

Pubmed 7670642,9074511

 

prodomImg

pubmed

21

700

S=1836 I=52 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

Pubmed 17294328

 

prodomImg

pubmed

27

697

S=1786 I=51 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

Pubmed 10537215

 

prodomImg

pubmed

17

698

S=1721 I=51 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

Pubmed 12324346

 

prodomImg

sp_Pdown

sp|Q9PAC7|PPK_XYLFA

1

700

S=2778 I=77 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

sp_Pdown

sp|Q87A63|PPK_XYLFT

1

700

S=2767 I=77 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

sp_Pdown

sp|Q9S646|PPK_PSEAE

23

700

S=1888 I=54 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

sp_Pdown

sp|Q87UP6|PPK_PSESM

21

700

S=1848 I=52 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

sp_Pdown

sp|Q88CG4|PPK_PSEPK

12

700

S=1835 I=52 E=0

Polyphosphate kinase EC=2.7.4.1 ; ATP-binding Nucleotide-binding Phosphoprotein Transferase

Iprscan [G3DSA:3.30.870.10]

352

519

-

Iprscan [MF_00347]

24

700

-

Iprscan IPR003414 [PIRSF015589]

21

699

Polyphosphate kinase

Iprscan IPR003414 [PF02503]

27

699

Polyphosphate kinase

Iprscan IPR003414 [TIGR03705]

26

699

Polyphosphate kinase

Iprscan [seg]

220

229

-

Iprscan [seg]

254

269

-

PD908875

31

361

S=602 I=43 E=3.12284e-65

PD007846

417

571

S=463 I=60 E=1.88947e-48

PD883751

587

698

S=370 I=59 E=3.24265e-37

PDA1F7M2

358

420

S=213 I=67 E=3.51286e-18

PDA1I0U2

572

613

S=176 I=76 E=1.29475e-13

PDA1T6D7

596

618

S=132 I=100 E=2.19457e-08

PDA1T6D6

596

618

S=121 I=91 E=5.06396e-07

PDA9J8B0

1

20

S=113 I=95 E=4.71885e-06

PDA5M153

596

618

S=112 I=87 E=6.02363e-06

PDA5M184

571

610

S=110 I=60 E=1.18906e-05

Iprscan [SSF56024]

353

517

-

Iprscan [SSF56024]

519

662

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DJzWf2HL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

260 hits
swiss-prot

Swiss-Prot ncbi-blastp

87 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10440.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10440.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr10440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_2918695_2919816_r1_XFF4834R-XFF4834R_chr25300 XFF4834R_chr25300
XFF4834R_chr25290
XFF4834R_chr25290
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25310
XFF4834R_chr25310
ID XFF4834R_chr_2918695_2919816_r1_XFF4834R-XFF4834R_chr25300
AC XFF4834R_chr25300
LT XFF4834R_chr25300
OR XFF4834R_chr from 2918695 to 2919816 on strand -
DE Putative phytase protein
IP NHL repeat. subgroup;
CL 1.8.1 Phosphorous metabolism GO:0006793
EC
GO InterPro


Curated
PM
AN publi xantho oryzae :PhyA, a secreted protein of Xanthomonas oryzae pv. oryzae, is required for optimum virulence and growth on phytic acid as a sole phosphate source.
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 40468.2 Da
SQ 373 aa
 
........10........20........30........40........50
| | | | |
MIPLRTVVQVTLLSAAAALVGCASAPAGREADEALLKDPLLSEARVAHEV
VPEAFITALTPSDNLDSPASWMAPDGRRWVIATAKGTHALVVFDGDSGKR
LRVVGGKGKALGKLDRPNGISVVDDLVFVVERDNRRVQVFSLPDLTPVTA
FGQNELREPYGLWVRKHDGGYEAVVSDNYMSPANKDLPPPLAELGQRFRR
YQLNAAGQGWQARLTQSFGDTSEAGAVRIAESVFGDEANARLMIAEEDVA
VGTQLRDYGMDGRYRGRNVGAGVFKAQAEGIGLFACSDGSGYWIATDQFK
DRSVFQVFDRKTLAHVGAFAGRVTANTDGVWLDQRSDARFPGGVFYALHD
DQAVAAFDWRDIARTLRLKECTP
XFF4834R

YP_364432.1 lcl|XCV2701

1

373

S=1607 I=84 E=0

putative phytase precursor

XFF4834R

NP_642834.1 lcl|XAC2519-XAC2519

29

373

S=1598 I=89 E=0

hypothetical protein

XFF4834R

NP_637738.1 lcl|XCC2384

5

371

S=1469 I=77 E=7.50094e-171

hypothetical protein

pubmed

1

373

S=1530 I=79 E=1.20916e-176

Putative phytase ; Signal

Pubmed 14601665

 

prodomImg

pubmed

66

370

S=141 I=25 E=2.94009e-08

Beta-propeller phytase EC=3.1.3.8 ; Hydrolase

Pubmed 19139877

 

prodomImg

Iprscan [G3DSA:2.120.10.20]

40

367

-

Iprscan IPR013017 [PS51125]

86

96

NHL repeat. subgroup

Iprscan IPR013017 [PS51125]

101

143

NHL repeat. subgroup

Iprscan [PS51257]

1

22

-

Iprscan [seg]

12

28

-

Iprscan [seg]

98

114

-

Iprscan [seg]

256

267

-

Iprscan [SignalP-NN(euk)]

1

18

-

PDA1W0G4

141

373

S=1112 I=91 E=3.11753e-127

PD692078

29

87

S=272 I=85 E=1.98511e-25

Iprscan [SSF50956]

35

370

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3CHNC0Uz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr25300.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr25300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr25300.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr25300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4621933_4623327_f1_XFF4834R-XFF4834R_chr40020 XFF4834R_chr40020
XFF4834R_chr40010
XFF4834R_chr40010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40030
XFF4834R_chr40030
ID XFF4834R_chr_4621933_4623327_f1_XFF4834R-XFF4834R_chr40020
AC XFF4834R_chr40020
LT XFF4834R_chr40020
OR XFF4834R_chr from 4622026 to 4623327 on strand +
DE putative acid phosphatase protein
IP Histidine phosphatase superfamily, clade-2
CL 1.8.1 Phosphorous metabolism GO:0006793
EC
GO InterPro
Molecular Function: acid phosphatase activity (GO:0003993)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100824)
MW 46109.9 Da
SQ 433 aa
 
........10........20........30........40........50
| | | | |
MLLRFCRRATALLGLALVPLTPAHATDATPDTLEKVVILKRHGVRAAMSS
PERLGRYSLHAWPHFGVPAGHLTANGAHLERLFGDYYRARYTALGLLNGD
GCNQAYYWANRTQRTIASAQALASTLTPGCADPVHHVPTGSSDVLFDGTA
ALRQPQARARMQAAIAGRIGGDARAWNATQSDALDTLEHLLLQCAQRPCP
AQAAPGKLRLTTVPAGLDDAGPSFPGLDGPAAAASGITESLLMGWADGQD
FAALGWQDLDEATLLRVFAPHQAEFALRLRAPTVARLASTPLATRLLATL
QQGSDAHAAADAIGGDARLVVVSGHDGTLTLLAGMFDLHWQLPGYQSDQT
VPGGALVFERWRRADGQRVIRLRYTAQSLTQLRERVPLTLQAPPPSAAIF
IPGCSTATPAYDCPLPQFARIVQAALDPLALDH
XFF4834R

XFF4834R_chr08180 lcl|appA-XFF4834R_chr08180

227

427

S=226 I=33 E=1.09256e-20

phosphoanhydride phosphorylase

XFF4834R

XFF4834R_chr08180 lcl|appA-XFF4834R_chr08180

34

146

S=189 I=40 E=3.35315e-16

phosphoanhydride phosphorylase

XFF4834R

XFF4834R_chr05530 lcl|XFF4834R_chr05720977_0631248_f1_XFF4834R-XFF4834R_chr05530

234

428

S=184 I=32 E=1.088e-15

XFF4834R

XFF4834R_chr05530 lcl|XFF4834R_chr05720977_0631248_f1_XFF4834R-XFF4834R_chr05530

36

148

S=168 I=39 E=1.05815e-13

XFF4834R

YP_365956.1 lcl|XCV4225

1

433

S=1716 I=79 E=0

putative acid phosphatase precursor

XFF4834R

NP_644431.2 lcl|appA-XAC4132

34

433

S=1709 I=85 E=0

6-phytase

XFF4834R

lcl|XALc_2788

227

427

S=254 I=36 E=1.62115e-23

putative acid phosphatase protein

XFF4834R

lcl|XALc_2788

34

146

S=159 I=44 E=5.44433e-12

putative acid phosphatase protein

XFF4834R

NP_641164.2 lcl|appA-XAC0812

227

427

S=237 I=33 E=1.91003e-21

phosphoanhydride phosphohydrolase

XFF4834R

NP_641164.2 lcl|appA-XAC0812

34

146

S=190 I=40 E=7.67483e-16

phosphoanhydride phosphohydrolase

XFF4834R

NP_636151.1 lcl|appA-XCC0760

227

428

S=236 I=33 E=2.29381e-21

phosphoanhydride phosphohydrolase

XFF4834R

NP_636151.1 lcl|appA-XCC0760

34

146

S=175 I=38 E=5.50118e-14

phosphoanhydride phosphohydrolase

XFF4834R

YP_362595.1 lcl|appA-XCV0864

227

427

S=217 I=32 E=4.17928e-19

phosphoanhydride phosphohydrolase / 4-phytase multifunctional enzyme

XFF4834R

YP_362595.1 lcl|appA-XCV0864

34

146

S=185 I=39 E=3.56036e-15

phosphoanhydride phosphohydrolase / 4-phytase multifunctional enzyme

XFF4834R

YP_362321.1 lcl|appA-XCV0590

234

428

S=190 I=33 E=7.74203e-16

acid phosphatase precursor

XFF4834R

YP_362321.1 lcl|appA-XCV0590

36

148

S=183 I=40 E=5.60263e-15

acid phosphatase precursor

XFF4834R

NP_640910.1 lcl|appA-XAC0557

234

428

S=190 I=32 E=7.74203e-16

6-phytase

XFF4834R

NP_640910.1 lcl|appA-XAC0557

36

148

S=182 I=39 E=8.22239e-15

6-phytase

pubmed

34

423

S=450 I=32 E=1.29852e-45

PhyA2

Pubmed 15251209

 

prodomImg

pubmed

34

423

S=445 I=31 E=4.03362e-45

Phytase

Pubmed 15251209

 

prodomImg

pubmed

34

428

S=399 I=30 E=1.55164e-39

Phytase EC=3.1.3.26 ; Hydrolase

Pubmed 17034758,17657539

 

prodomImg

pubmed

34

428

S=388 I=31 E=4.08065e-38

Acid phosphatase/phytase 2

Pubmed 10092520

 

prodomImg

pubmed

34

428

S=383 I=31 E=1.40739e-37

Periplasmic AppA protein EC=3.1.3.2 EC=3.1.3.26 ; Disulfide bond Hydrolase Multifunctional enzyme Signal

Pubmed 2168385

 

prodomImg

sp_Pdown

sp|P07102|PPA_ECOLI

34

428

S=383 I=31 E=9.57391e-38

Periplasmic AppA protein EC=3.1.3.2 EC=3.1.3.26 ; Disulfide bond Hydrolase Multifunctional enzyme Signal

sp_Pdown

sp|O33921|AGP_SALTY

9

147

S=182 I=33 E=2.4485e-13

Glucose-1-phosphatase EC=3.1.3.10 ; Hydrolase Periplasm Signal

sp_Pdown

sp|O33921|AGP_SALTY

225

425

S=170 I=25 E=7.46811e-12

Glucose-1-phosphatase EC=3.1.3.10 ; Hydrolase Periplasm Signal

sp_Pdown

sp|P19926|AGP_ECOLI

225

426

S=177 I=24 E=8.29872e-13

Glucose-1-phosphatase EC=3.1.3.10 ; Hydrolase Periplasm Signal

sp_Pdown

sp|P19926|AGP_ECOLI

9

147

S=176 I=31 E=1.20734e-12

Glucose-1-phosphatase EC=3.1.3.10 ; Hydrolase Periplasm Signal

Iprscan [G3DSA:3.40.50.1240]

26

432

-

Iprscan IPR000560 [PF00328]

32

374

Histidine phosphatase superfamily, clade-2

Iprscan [seg]

19

33

-

Iprscan [seg]

150

175

-

Iprscan [seg]

193

205

-

Iprscan [seg]

303

317

-

Iprscan [SignalP-NN(euk)]

1

25

-

PD838494

176

293

S=372 I=65 E=1.60862e-37

PD025090

318

432

S=289 I=50 E=1.68092e-27

PD704217

34

147

S=245 I=50 E=3.70088e-22

Iprscan [SSF53254]

25

427

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pYna50vT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

37 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr40020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr40020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr40020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBveLU7G/XFF4834R_chr40020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.