Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr16040tdcGXFF4834R_chr16040L-serine dehydratase

tdcG XFF4834R_chr16040
XFF4834R_chr16030
XFF4834R_chr16030
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16050
XFF4834R_chr16050
ID tdcG
AC XFF4834R_chr16040
LT XFF4834R_chr16040
OR XFF4834R_chr from 1852222 to 1853604 on strand -
DE L-serine dehydratase
IP Iron-sulphur-dependent L-serine dehydratase single chain form; Serine dehydratase alpha chain; Serine dehydratase beta chain
CL 1.7.8 Gluconeogenesis GO:0006094
EC
GO InterPro
4 sulfur cluster binding (GO:0051539)
Biological Process: gluconeogenesis (GO:0006094)
Molecular Function: L-serine ammonia-lyase activity (GO:0003941)

Curated
PM
AN L-serine dehydratase is found as a heterodimer of alpha and beta chain or as a fusion of the two chains in a single protein. This enzyme catalyses the deamination of serine to form pyruvate. This enzyme is part of the gluconeogenesis pathway. This entry also describes a number of proteins with no known function. classification is also Amino-acid degradation; L-threonine degradation via propanoate pathway.
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 49596.1 Da
SQ 460 aa
 
........10........20........30........40........50
| | | | |
MAVSTFDLFKIGIGPSSSHTVGPMRAAERFVHRWLLDAGRLQDVVRIRAE
VFGSLALTGRGHGTDKAVLLGLEGHRPNLIDPDIIPATLERIRASKRIAL
MGQHAIVFDEKRDLPMNKRQKLPYHTNGMRFTAYDADEAVIATRDYYSVG
GGFVVNQDDAADDRIVADETPLPYPFLSGDELLAQCARSGLSIAALMFEN
EKSWRSEDEIRAGLRELWNAMQSCVTRGIREEGTLPGGLNVSRRAPALYR
ELSSKPEAAMRDPLTTLDWVNLYALAVNEENAAGGRVVTAPTNGAAGIIP
AVLHYFDRFCAGASEQRIFDFLLTAAAIGILYKENASISGAEVGCQGEVG
VACSMAAGGLVAALGGNPGQIENAAEIGMEHNLGLTCDPIGGLVQIPCIE
RNAMGAVKAINASRMAMRGDGKHKVSLDKVIKTMRDTGRDMQDKYKETSR
GGLAVNVIEC
XFF4834R

NP_643345.1 lcl|sdaA-XAC3036

1

460

S=2376 I=97 E=0

L-serine dehydratase

XFF4834R

YP_364904.1 lcl|tdcG-XCV3173

1

460

S=2363 I=97 E=0

L-serine deaminase

XFF4834R

NP_638201.1 lcl|sdaA-XCC2853

1

460

S=2320 I=95 E=0

L-serine dehydratase

XFF4834R

lcl|XALc_2179

1

460

S=2167 I=87 E=0

putative l-serine dehydratase; l-serine deaminase protein

pubmed

1

460

S=1378 I=58 E=4.48731e-158

L-serine dehydratase

Pubmed 15914915

 

prodomImg

pubmed

3

460

S=1229 I=53 E=3.98125e-140

L-serine dehydratase 1 EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

Pubmed 2504697,8436113

 

prodomImg

pubmed

3

458

S=1229 I=54 E=4.49812e-140

L-serine dehydratase tdcG EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

Pubmed 16397293

 

prodomImg

pubmed

3

460

S=1202 I=52 E=9.4969e-137

L-serine dehydratase 2 EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

Pubmed 8385012

 

prodomImg

pubmed

29

392

S=857 I=48 E=5.34055e-95

L-serine dehydratase 1

Pubmed 16318732

 

prodomImg

pubmed

29

392

S=856 I=48 E=7.63542e-95

L-serine dehydratase 1

Pubmed 16318732

 

prodomImg

pubmed

29

392

S=855 I=48 E=8.85531e-95

L-serine dehydratase 1

Pubmed 16318732

 

prodomImg

pubmed

29

392

S=848 I=47 E=6.57809e-94

L-serine dehydratase 1

Pubmed 16318732

 

prodomImg

pubmed

29

392

S=847 I=47 E=9.24216e-94

L-serine dehydratase 1

Pubmed 16318732

 

prodomImg

pubmed

196

460

S=691 I=51 E=7.25159e-75

Putative L-serine deaminase SdaA

Pubmed 10817691

 

prodomImg

sp_Pdown

sp|O86564|SDHL_STRCO

1

460

S=1490 I=63 E=7.87326e-172

L-serine dehydratase EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|P16095|SDHL_ECOLI

3

460

S=1229 I=53 E=2.73994e-140

L-serine dehydratase 1 EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|P42630|TDCG_ECOLI

3

458

S=1229 I=54 E=3.09565e-140

L-serine dehydratase tdcG EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|P71349|SDHL_HAEIN

3

458

S=1202 I=50 E=5.78486e-137

L-serine dehydratase EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|P30744|SDHM_ECOLI

3

460

S=1202 I=52 E=6.53588e-137

L-serine dehydratase 2 EC=4.3.1.17 ; 4Fe-4S Gluconeogenesis Iron Iron-sulfur Lyase Metal-binding

Iprscan IPR005131 [PF03315]

4

162

Serine dehydratase beta chain

Iprscan IPR005130 [PF03313]

177

456

Serine dehydratase alpha chain

Iprscan IPR004644 [TIGR00720]

1

460

Iron-sulphur-dependent L-serine dehydratase single chain form

Iprscan [seg]

356

366

-

PD008627

195

349

S=538 I=66 E=1.07167e-57

PD579724

367

460

S=359 I=70 E=6.29042e-36

PD005716

89

159

S=217 I=52 E=9.42467e-19

PD428043

1

59

S=206 I=70 E=1.97586e-17

PD877883

6

85

S=171 I=48 E=3.35183e-13

PD589323

168

225

S=152 I=50 E=6.54814e-11

PDA0S7K2

60

201

S=121 I=27 E=4.14733e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XUEEl9P5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

12 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG63p1o/XFF4834R_chr16040.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG63p1o/XFF4834R_chr16040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG63p1o/XFF4834R_chr16040.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG63p1o/XFF4834R_chr16040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.