Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr36310galEXFF4834R_chr36310putative UDP-glucose 4-epimerase

galE XFF4834R_chr36310
XFF4834R_chr_3866
XFF4834R_chr_3866
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36320
XFF4834R_chr36320
ID galE
AC XFF4834R_chr36310
LT XFF4834R_chr36310
OR XFF4834R_chr from 4204857 to 4206032 on strand +
DE putative UDP-glucose 4-epimerase
IP NAD-dependent epimerase/dehydratase
CL 1.7.7 Galactose metabolism GO:0006012
EC
GO InterPro
Biological Process: galactose metabolic process (GO:0006012)
Biological Process: cellular metabolic process (GO:0044237)
Biological Process: metabolic process (GO:0008152)
Molecular Function: UDP-glucose 4-epimerase activity (GO:0003978)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: binding (GO:0005488)

Curated
PM
AN Aussi 1.6 Macromolecules (cellular constituent) biosynthesis. Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (EC:5.1.3.2) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100816)
MW 42956.4 Da
SQ 391 aa
 
........10........20........30........40........50
| | | | |
MRILVTGGTGYIGSHTCVELARRGHEVCIVDNLSNSSERVLDHLQHLMGF
RPEFHRMDVRAPELADLLIGKRIDAVLHFAALKAVGESVREPLLYFNNNV
TGTLALLRAMRAAKVCNLVFSSSATVYGDANRSPIDESAPLKAINPYGRT
KLMMEEMIGDLGAAWPDFNAALLRYFNPVGAHPSGYLGEDPRGVPNNLMP
YIAQVAVGHREALQVFGDDYPTDDGTGVRDYLHVMDLARAHVDAIDYLQR
ERKGLVVNLGTGRGYSVREVAAAFARASGRRIPLSVAPRRDGDGDVAVYF
ASTALANRLLGWTAEYDLDRMCRDTWRWQSMHPDGYAGSRLPLLRTAAAV
PEREGARELPAPAPRLSPGPDTRRRSEPVRTLVVANGFSRA
XFF4834R

XFF4834R_chr37960 lcl|XFF4834R_chr41040994_4385959_f2_XFF4834R-XFF4834R_chr37960

1

328

S=201 I=29 E=9.12676e-18

XFF4834R

XFF4834R_chr34890 lcl|XFF4834R_chr38050206_4046940_r1_XFF4834R-XFF4834R_chr34890

74

328

S=156 I=30 E=2.31025e-12

XFF4834R

XFF4834R_chr34790 lcl|rffG-XFF4834R_chr34790

5

260

S=134 I=29 E=1.13727e-09

dTDP-glucose 4,6-dehydratase

XFF4834R

NP_644047.1 lcl|XAC3740-XAC3740

1

390

S=1969 I=97 E=0

UDP-glucose 4-epimerase

XFF4834R

YP_365590.1 lcl|galE-XCV3859

1

391

S=1897 I=93 E=0

UDP-glucose 4-epimerase

XFF4834R

NP_639042.1 lcl|XCC3696

1

391

S=1615 I=81 E=0

UDP-glucose 4-epimerase

XFF4834R

lcl|gla-XALc_0106

1

312

S=204 I=28 E=1.40692e-17

putative nucleoside-diphosphate-sugar epimerases protein

XFF4834R

NP_639193.1 lcl|wbnF-XCC3853

1

312

S=204 I=29 E=1.41924e-17

nucleotide sugar epimerase

XFF4834R

NP_644209.1 lcl|wbnF-XAC3908

1

328

S=204 I=29 E=1.61753e-17

nucleotide sugar epimerase

XFF4834R

YP_365752.1 lcl|wbnF-XCV4021

1

328

S=197 I=28 E=1.1808e-16

nucleotide sugar epimerase

XFF4834R

NP_640410.1 lcl|rmd-XAC0054

1

318

S=171 I=28 E=1.36602e-13

degenerated UDP-glucose epimerase

XFF4834R

YP_365440.1 lcl|rmlB-XCV3709

4

328

S=155 I=28 E=1.35191e-11

dTDP-glucose 4,6-dehydratase

XFF4834R

NP_643892.1 lcl|rmlB-XAC3585

4

328

S=151 I=28 E=3.65265e-11

dTDP-glucose 4,6-dehydratase

XFF4834R

YP_365448.1 lcl|rmd-XCV3717

2

328

S=150 I=24 E=5.64851e-11

NDP-hexose oxidoreductase

XFF4834R

lcl|rmlB-XALc_2697

4

338

S=146 I=28 E=1.44836e-10

probable dtdp-glucose 4,6-dehydratase protein

XFF4834R

NP_636013.1 lcl|rmlB-XCC0621

4

328

S=142 I=28 E=4.99528e-10

dTDP-glucose 4,6-dehydratase

XFF4834R

NP_636000.1 lcl|rmd-XCC0608

2

218

S=140 I=27 E=8.80405e-10

UDP-glucose 4-epimerase

XFF4834R

lcl|rmd-XALc_2707

74

318

S=135 I=26 E=3.17175e-09

probable ndp-hexose oxidoreductase protein

XFF4834R

NP_635614.1 lcl|cdh-XCC0219

1

126

S=114 I=35 E=1.28885e-06

NAD(P)H steroid dehydrogenase

XFF4834R

lcl|XALc_3068

1

158

S=111 I=32 E=2.70429e-06

putative nad(p)h steroid dehydrogenase protein

XFF4834R

lcl|gmd-XALc_2706

4

248

S=110 I=27 E=3.63743e-06

probable gdp-mannose 4,6-dehydratase protein

pubmed

1

336

S=984 I=57 E=1.74312e-110

GalE ; Isomerase NAD

Pubmed 17098903

 

prodomImg

pubmed

1

337

S=981 I=57 E=4.1323e-110

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

Pubmed 7551062

 

prodomImg

pubmed

1

336

S=977 I=57 E=1.2182e-109

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

Pubmed 2198256

 

prodomImg

pubmed

1

336

S=973 I=56 E=3.75126e-109

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

Pubmed 3022232

 

prodomImg

pubmed

1

336

S=972 I=57 E=6.22006e-109

UDP-glucose 4-epimerase ; Isomerase NAD

Pubmed 18540088

 

prodomImg

sp_Pdown

sp|Q56093|GALE_SALTI

1

337

S=981 I=57 E=2.81045e-110

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

sp_Pdown

sp|P22715|GALE_SALTY

1

336

S=977 I=57 E=8.2852e-110

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

sp_Pdown

sp|P09147|GALE_ECOLI

1

336

S=973 I=56 E=2.5513e-109

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

sp_Pdown

sp|P55180|GALE_BACSU

1

340

S=958 I=55 E=1.67604e-107

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

sp_Pdown

sp|Q553X7|GALE_DICDI

2

339

S=957 I=53 E=2.61455e-107

UDP-glucose 4-epimerase EC=5.1.3.2 ; Carbohydrate metabolism Galactose Isomerase NAD

Iprscan IPR016040 [G3DSA:3.40.50.720]

2

235

NAD(P)-binding domain

Iprscan IPR005886 [PTHR10366:SF39]

5

337

UDP-glucose 4-epimerase

Iprscan [PTHR10366]

5

337

-

Iprscan IPR001509 [PF01370]

3

260

NAD-dependent epimerase/dehydratase

Iprscan IPR005886 [TIGR01179]

2

336

UDP-glucose 4-epimerase

PDA0W2G3

83

328

S=273 I=30 E=1.36582e-25

PD505364

175

236

S=257 I=76 E=9.705e-24

PDA1Z150

40

87

S=217 I=90 E=8.26085e-19

PDA969W8

1

155

S=164 I=31 E=2.25987e-12

PDA8U4F8

127

293

S=162 I=26 E=3.5873e-12

PDA881M6

85

174

S=147 I=38 E=2.27585e-10

PD558077

282

338

S=142 I=50 E=9.67619e-10

PDA6B7N9

5

52

S=129 I=52 E=3.08281e-08

PDA2W8Q0

339

389

S=115 I=82 E=1.85611e-06

PD000038

85

126

S=113 I=65 E=3.15923e-06

Iprscan IPR016040 [SSF51735]

1

356

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BS9pDCFx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

133 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJn3QX/XFF4834R_chr36310.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJn3QX/XFF4834R_chr36310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJn3QX/XFF4834R_chr36310.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJn3QX/XFF4834R_chr36310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.