Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr33990XFF4834R_chr36830635_3921582_r1_XFF4834R-XFF4834R_chr33990XFF4834R_chr33990putative glycerophosphodiester phosphodiesterase
  2. XFF4834R_chr42910glpQXFF4834R_chr42910periplasmic glycerophosphodiester phosphodiesterase

XFF4834R_chr36830635_3921582_r1_XFF4834R-XFF4834R_chr33990 XFF4834R_chr33990
XFF4834R_chr33980
XFF4834R_chr33980
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3609
XFF4834R_chr_3609
ID XFF4834R_chr36830635_3921582_r1_XFF4834R-XFF4834R_chr33990
AC XFF4834R_chr33990
LT XFF4834R_chr33990
OR XFF4834R_chr from 3920635 to 3921582 on strand -
DE putative glycerophosphodiester phosphodiesterase
IP Glycerophosphoryl diester phosphodiesterase; PLC-like phosphodiesterase, TIM beta/alpha-barrel domain
CL 1.7.6 Glycerol metabolism GO:0006071
EC
GO InterPro
Biological Process: lipid metabolic process (GO:0006629)
Biological Process: glycerol metabolic process (GO:0006071)
Molecular Function: glycerophosphodiester phosphodiesterase activity (GO:0008889)
Molecular Function: phosphoric diester hydrolase activity (GO:0008081)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100503)
MW 33399.1 Da
SQ 315 aa
 
........10........20........30........40........50
| | | | |
MTSRPIAVLAVVLCAVVATAASAAPTGVAAIQARLTNPQGGIVVVAHRGC
HAAAPQHGFIETAPENSLAALERCIAIGADVMETDVRRAADGSLVMLHDA
TVDRTTDGTGKLSELTLADLQTLRLRSDEGGAQAPLTDQRVVTLEQMLAK
AKGHILLNLDVKDAIYVQVIDAVARAGMQHQVIVKAEAGIFTAPLAAMPP
FDTVYFFPILINAHGKADLAAIATAQTRNARPMAFELPKMTAAQLPALAA
VSKAHNVRLMVNSLWDGFIAGYGGDADAERDPDKVWGRMYRDGVSIIQTD
APEALLRYRATLEKR
XFF4834R

XFF4834R_chr00460 lcl|XFF4834R_chr00460157_0059301_f1_XFF4834R-XFF4834R_chr00460

41

148

S=111 I=35 E=5.84021e-07

XFF4834R

XFF4834R_chr40440 lcl|XFF4834R_chr_4675416_4676516_r2_XFF4834R-XFF4834R_chr40440

31

106

S=95 I=37 E=5.29726e-05

XFF4834R

XFF4834R_chr00460 lcl|XFF4834R_chr00460157_0059301_f1_XFF4834R-XFF4834R_chr00460

41

148

S=111 I=35 E=5.84021e-07

XFF4834R

XFF4834R_chr40440 lcl|XFF4834R_chr_4675416_4676516_r2_XFF4834R-XFF4834R_chr40440

31

106

S=95 I=37 E=5.29726e-05

XFF4834R

NP_641483.1 lcl|glpQ-XAC1147

43

315

S=1391 I=97 E=1.90578e-161

glycerophosphodiester phosphodiesterase

XFF4834R

YP_362897.1 lcl|XCV1166

44

315

S=1383 I=97 E=1.50478e-160

putative glycerophosphodiester phosphodiesterase

XFF4834R

NP_636417.1 lcl|glpQ-XCC1042

43

315

S=1297 I=90 E=4.63546e-150

glycerophosphodiester phosphodiesterase

XFF4834R

lcl|XALc_0647

31

313

S=943 I=62 E=3.18291e-107

hypothetical glycerophosphodiester phosphodiesterase protein

XFF4834R

lcl|XALc_0552

34

308

S=347 I=37 E=5.3287e-35

putative glycerophosphoryl diester phosphodiesterase protein

XFF4834R

NP_635447.1 lcl|avrBs2-XCC0052

41

151

S=115 I=36 E=7.37779e-07

avirulence protein

XFF4834R

NP_640432.1 lcl|avrBs2-XAC0076

41

148

S=112 I=36 E=1.57526e-06

avirulence protein

XFF4834R

YP_361783.1 lcl|avrBs2-XCV0052

41

148

S=109 I=34 E=3.83333e-06

avirulence protein AvrBs2

pubmed

42

162

S=172 I=35 E=3.49612e-12

Putative glycerophosphodiester phosphodiesterase EC=3.1.-.- Putative uncharacterized protein yhdW ; Hydrolase

Pubmed 8113174,8045899

 

prodomImg

pubmed

34

162

S=170 I=35 E=5.13089e-12

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Polymorphism Transmemb

Pubmed 10760272,10493829

 

prodomImg

pubmed

62

186

S=169 I=33 E=7.66252e-12

Glycerophosphodiester phosphodiesterase

Pubmed 15168170

 

prodomImg

pubmed

63

162

S=165 I=38 E=2.6198e-11

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

Pubmed 10760272

 

prodomImg

pubmed

63

162

S=164 I=38 E=3.28638e-11

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

Pubmed 10760272

 

prodomImg

pubmed

56

162

S=154 I=37 E=5.03378e-10

Orf1 protein

Pubmed 8867378

 

prodomImg

pubmed

62

186

S=153 I=31 E=7.01102e-10

Glycerophosphodiester phosphodiesterase

Pubmed 15168170

 

prodomImg

pubmed

64

143

S=142 I=39 E=1.32383e-08

Probable glycerophosphodiester phosphodiesterase YPL206C EC=3.1.4.46 ; Endoplasmic reticulum Hydrolase Membrane Transmembrane

Pubmed 12514182

 

prodomImg

pubmed

58

162

S=142 I=34 E=1.61779e-08

GdpD

Pubmed 16461712

 

prodomImg

pubmed

42

123

S=140 I=37 E=2.2143e-08

Glycerophosphoryl diester phosphodiesterase EC=3.1.4.46 ; Calcium Glycerol metabolism Hydrolase Metal-binding

Pubmed 8012593

 

prodomImg

sp_Pdown

sp|Q3T0T0|GDE1_BOVIN

34

179

S=177 I=33 E=5.76149e-13

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

sp_Pdown

sp|Q9NZC3|GDE1_HUMAN

34

162

S=170 I=35 E=3.53287e-12

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Polymorphism Transmemb

sp_Pdown

sp|Q9JL56|GDE1_MOUSE

63

162

S=165 I=38 E=1.80386e-11

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

sp_Pdown

sp|Q9JL55|GDE1_RAT

63

162

S=164 I=38 E=2.26284e-11

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

sp_Pdown

sp|P54527|YQIK_BACSU

64

184

S=143 I=33 E=8.35417e-09

Uncharacterized protein yqiK

PD689019

130

308

S=296 I=41 E=2.3921e-28

PD542577

31

144

S=173 I=43 E=1.86683e-13

PDA8J180

143

269

S=126 I=30 E=7.63317e-08

PDA4Y8E6

126

185

S=107 I=45 E=1.67019e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one V5MVYcIU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

9 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr33990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr33990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr33990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr33990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glpQ XFF4834R_chr42910
XFF4834R_chr42900
XFF4834R_chr42900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42920
XFF4834R_chr42920
ID glpQ
AC XFF4834R_chr42910
LT XFF4834R_chr42910
OR XFF4834R_chr from 4971718 to 4972917 on strand -
DE periplasmic glycerophosphodiester phosphodiesterase
IP Glycerophosphoryl diester phosphodiesterase; PLC-like phosphodiesterase, TIM beta/alpha-barrel domain
CL 1.7.6 Glycerol metabolism GO:0006071
EC
GO InterPro
Biological Process: glycerol metabolic process (GO:0006071)
Biological Process: lipid metabolic process (GO:0006629)
Molecular Function: phosphoric diester hydrolase activity (GO:0008081)
Molecular Function: glycerophosphodiester phosphodiesterase activity (GO:0008889)

Curated
PM
AN GenProtEC : Metabolism --> Central intermediary metabolism --> Glycerol metabolism --> Glycerol degradation I Location of gene products --> Periplasmic space
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: validated by darrasse (20120412)
MW 43271 Da
SQ 399 aa
 
........10........20........30........40........50
| | | | |
MMRDARVQSSLRIAHRPGPPCDPSLIRYLFSVETCMMQFGRLCLVGAMMM
GMSGPAVAEAPLAKTVQIFAHRGASALRPEHTLASYAKAIVDGADFVEPD
LVSTKDGVLIARHENEIGGTTDVASHPQFAARKTRKTIDGQAMEGWFTED
FSLAELKTLRARERLPQLRGTRWDGHFQIVTFDEIIDFVAAESAATGRPI
GLIPEIKHPSYFKALGLPMEDKVLATLHAHAYTRTAPVIIQSFETGNLRY
LRGKIGRTSNIRLLQLLGGAQMALPDAGTDGAPKTYGQMITPDGLKQVAS
YADAIGPDIRSIIPLDAQQRLGTPTSLVHDAHAAGLQVQPYTFRPENYFL
AANNRSSGAVTERNDAGALVELQAYLDAGIDAFFADDPGLARRALSGHP
XFF4834R

NP_644661.1 lcl|glpQ-XAC4367

32

399

S=1797 I=93 E=0

glycerophosphoryl diester phosphodiesterase

XFF4834R

YP_366210.1 lcl|XCV4479

49

399

S=1676 I=92 E=0

putative glycerophosphoryl diester phosphodiesterase

XFF4834R

NP_639568.1 lcl|glpQ-XCC4234

32

397

S=1606 I=84 E=0

glycerophosphoryl diester phosphodiesterase

XFF4834R

lcl|XALc_0326

68

399

S=1023 I=62 E=9.04867e-117

putative glycerophosphoryl diester phosphodiesterase protein

pubmed

42

344

S=340 I=32 E=2.00581e-32

Glycerophosphodiester phosphodiesterase GlpQ

Pubmed 11015364

 

prodomImg

pubmed

37

344

S=334 I=31 E=1.07916e-31

GlpQ

Pubmed 17370524

 

prodomImg

pubmed

64

344

S=332 I=33 E=1.61163e-31

Glycerophosphodiester phosphodiesterase

Pubmed 15131225

 

prodomImg

pubmed

37

346

S=332 I=33 E=1.72805e-31

Glycerophosphoryl diester phosphodiesterase EC=3.1.4.46 ; Calcium Glycerol metabolism Hydrolase Metal-binding Periplasm Signal

Pubmed 1851953

 

prodomImg

pubmed

37

344

S=331 I=31 E=2.58069e-31

Glycerophosphodiester phosphodiesterase GlpQ

Pubmed 11015364

 

prodomImg

pubmed

37

344

S=330 I=31 E=3.56317e-31

Glycerophosphodiester phosphodiesterase GlpQ

Pubmed 11015364

 

prodomImg

pubmed

42

344

S=327 I=31 E=7.47636e-31

38 kDa lipoprotein Gpd GlpQ Glycerophosphodiester phosphodiesterase

Pubmed 8880505,17552097

 

prodomImg

pubmed

64

344

S=325 I=33 E=1.46302e-30

GlpQ Glycerophosphodiester phosphodiesterase

Pubmed 16177341,17552097

 

prodomImg

pubmed

68

344

S=323 I=33 E=2.53397e-30

GlpQ

Pubmed 16729949

 

prodomImg

pubmed

68

344

S=322 I=34 E=2.9905e-30

Glycerophosphodiester phosphodiesterase Glycerophosphodiester phosphodiesterase GlpQ

Pubmed 11015364,16081922

 

prodomImg

sp_Pdown

sp|P09394|GLPQ_ECOLI

37

346

S=332 I=33 E=1.18934e-31

Glycerophosphoryl diester phosphodiesterase EC=3.1.4.46 ; Calcium Glycerol metabolism Hydrolase Metal-binding Periplasm Signal

sp_Pdown

sp|Q06282|GLPQ_HAEIN

68

381

S=301 I=28 E=8.29105e-28

Glycerophosphoryl diester phosphodiesterase EC=3.1.4.46 ; Calcium Cell membrane outer Glycerol metabolism Hydrolase Lipoprotein Metal-binding Pa

sp_Pdown

sp|O30405|GLPQ_TREPA

68

346

S=261 I=29 E=5.02302e-23

Glycerophosphoryl diester phosphodiesterase EC=3.1.4.46 ; Cell membrane outer Glycerol metabolism Hydrolase Lipoprotein Palmitate Signal

sp_Pdown

sp|Q7Y208|GLPQ3_ARATH

68

362

S=184 I=29 E=9.58714e-14

Probable glycerophosphoryl diester phosphodiesterase 3 EC=3.1.4.46 ; Cell membrane Glycerol metabolism Glycoprotein GPI-anchor Hydrolase Lip

sp_Pdown

sp|P37965|GLPQ_BACSU

70

248

S=147 I=32 E=3.0468e-09

Glycerophosphoryl diester phosphodiesterase EC=3.1.4.46 ; Calcium Glycerol metabolism Hydrolase Metal-binding

Iprscan IPR017946 [G3DSA:3.20.20.190]

58

398

PLC-like phosphodiesterase, TIM beta/alpha-barrel domain

Iprscan IPR004129 [PF03009]

71

390

Glycerophosphoryl diester phosphodiesterase

Iprscan [seg]

263

274

-

PDA096I2

123

358

S=260 I=32 E=4.50323e-24

PD455929

163

241

S=208 I=51 E=8.76817e-18

PD600552

242

318

S=174 I=47 E=1.24941e-13

PD309478

319

366

S=160 I=73 E=6.1022e-12

PDA1Q7Y0

367

398

S=152 I=97 E=5.1663e-11

PDA2I7N9

32

65

S=141 I=82 E=1.41923e-09

PDA1S7A7

145

169

S=133 I=100 E=1.3225e-08

PDA44596

120

161

S=127 I=52 E=5.97671e-08

PD643255

120

176

S=127 I=46 E=6.29769e-08

PD542577

68

121

S=124 I=49 E=1.30993e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one enI58ts4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

38 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr42910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr42910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr42910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpolaIt/XFF4834R_chr42910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.